Search This Blog

Wednesday, July 4, 2018

Qi

From Wikipedia, the free encyclopedia

Qi (Ch'i)
Qi 3 forms.jpg
Chinese name
Traditional Chinese
Simplified Chinese
Burmese name
Burmese အသက်
IPA aasaat
Vietnamese name
Vietnamese alphabet khí
Thai name
Thai ลมปราณ
RTGS lmprāṇ
Korean name
Hangul
Hanja
Mongolian name
Mongolian Cyrillic хийг
Mongolian script ᠬᠡᠢ ᠶᠢ
Japanese name
Kyūjitai
Shinjitai
Malay name
Malay chi
Indonesian name
Indonesian chi
Filipino name
Tagalog qi
Lao name
Lao ຊີວິດ
Khmer name
Khmer ឈី
Tetum name
Tetum qi

In traditional Chinese culture, qi or ch'i (About this sound ) is believed to be a vital force forming part of any living entity. Qi translates as "air" and figuratively as "material energy", "life force", or "energy flow".[4] Qi is the central underlying principle in Chinese traditional medicine and in Chinese martial arts. The practice of cultivating and balancing qi is called qigong.

There is widespread[quantify] belief in the reality of qi, with believers describing it as a vital energy whose flow must be balanced for health. Qi is a non-scientific, unverified concept,[4][5] which has never been directly observed, and is unrelated to the concept of energy used in science[6][7][8] (vital energy is itself an abandoned scientific notion).[9]

Linguistic aspects

The cultural keyword is analyzable in terms of Chinese and Sino-Xenic pronunciations. Possible etymologies include the logographs 氣, 气, and 気 with various meanings ranging from "vapor" to "anger", and the English loanword qi or ch'i.

Pronunciations and etymologies

The logograph 氣 is read with two Chinese pronunciations, the usual 氣 "air; vital energy" and the rare archaic 氣 "to present food" (later disambiguated with 餼).

Pronunciations of 氣 in modern varieties of Chinese with standardized IPA equivalents include: Standard Chinese /t͡ɕʰi⁵¹/, Wu Chinese qi /t͡ɕʰi³⁴/, Southern Min khì /kʰi²¹/, Eastern Min /kʰɛi²¹³/, Standard Cantonese hei3 /hei̯³³/, and Hakka Chinese hi /hi⁵⁵/.

Pronunciations of 氣 in Sino-Xenic borrowings include: Japanese ki, Korean gi, and Vietnamese khi.

Reconstructions of the Middle Chinese pronunciation of 氣 standardized to IPA transcription include: /kʰe̯iH/ (Bernard Karlgren), /kʰĭəiH/ (Wang Li), /kʰiəiH/ (Li Rong), /kʰɨjH/ (Edwin Pulleyblank), and /kʰɨiH/ (Zhengzhang Shangfang).

Reconstructions of the Old Chinese pronunciation of 氣 standardized to IPA transcription include: /*kʰɯds/ (Zhengzhang Shangfang) and /*C.qʰəp-s/ (William H. Baxter and Laurent Sagart).

The etymology of interconnects with Kharia kʰis "anger", Sora kissa "move with great effort", Khmer kʰɛs "strive after; endeavor", and Gyalrongic kʰɐs "anger".[10]

Characters

In the East Asian languages, has three logographs:
In addition, is an uncommon character especially used in writing Daoist talismans. Historically, the word was generally written as 气 until the Han dynasty (206 BCE–220 CE), when it was replaced by the 氣 graph clarified with "rice" indicating "steam (rising from rice as it cooks.)"
This primary logograph 气, the earliest written character for qì, consisted of three wavy horizontal lines seen in Shang dynasty (c. 1600–1046 BCE) oracle bone script, Zhou dynasty (1046–256 BCE) bronzeware script and large seal script, and Qin dynasty (221–206 BCE) small seal script. These oracle, bronze, and seal scripts logographs 气 were used in ancient times as a phonetic loan character to write 乞 "plead for; beg; ask" which did not have an early character.

The vast majority of Chinese characters are classified as radical-phonetic characters. Such characters combine a semantically suggestive "radical characters" with a phonetic element approximating ancient pronunciation. For example, the widely known word dào "the Dao; the way" graphically combines the "walk" radical 辶 with a shǒu 首 "head" phonetic. Although the modern dào and shǒu pronunciations are dissimilar, the Old Chinese *lˤuʔ-s 道 and *l̥uʔ-s 首 were alike. The regular script character is unusual because is both the "air radical" and the phonetic, with 米 "rice" semantically indicating "steam; vapor".

This 气 "air/gas radical" was only used in a few native Chinese characters like yīnyūn 氤氲 "thick mist/smoke", but was also used to create new scientific characters for gaseous chemical elements. Some examples are based on pronunciations in European languages: 氟 (with a 弗 phonetic) "fluorine" and nǎi 氖 (with a nǎi 乃 phonetic) "neon". Others are based on semantics: qīng 氫 (with a jīng 巠 phonetic, abbreviating qīng 輕 "light-weight") "hydrogen (the lightest element)" and 氯 (with a 彔 phonetic, abbreviating 綠 "green") "(greenish-yellow) chlorine".

氣 is the phonetic element in a few characters such as kài 愾 "hate" with the "heart-mind radical" 忄or 心, 熂 "set fire to weeds" with the "fire radical" 火, and 餼 "to present food" with the "food radical" 食.

The first Chinese dictionary of characters, the Shuowen Jiezi(121 CE) notes that the primary 气 is a pictographic character depicting 雲气 "cloudy vapors", and that the full 氣 combines 米 "rice" with the phonetic qi 气, meaning 饋客芻米 "present provisions to guests" (later disambiguated as 餼).

Meanings

Qi is a polysemous word. The unabridged Chinese-Chinese character dictionary Hanyu Da Zidian defines it as "present food or provisions" for the pronunciation but also lists 23 meanings for the pronunciation.[11] The modern ABC Chinese-English Comprehensive Dictionary, which enters 餼 "grain; animal feed; make a present of food", and a 氣 entry with seven translation equivalents for the noun, two for bound morphemes, and three equivalents for the verb.
n. ① air; gas ② smell ③ spirit; vigor; morale ④ vital/material energy (in Ch[inese] metaphysics) ⑤ tone; atmosphere; attitude ⑥ anger ⑦ breath; respiration b.f. ① weather 天氣 tiānqì ② [linguistics] aspiration 送氣 sòngqì v. ① anger ② get angry ③ bully; insult.[12]

English borrowing

Qi was an early Chinese loanword in English. It was romanized as k'i in Church Romanization in the early-19th century, as ch'i in Wade–Giles in the mid-19th century (sometimes misspelled chi omitting the apostrophe), and as qi in Pinyin in the mid-20th century. The Oxford English Dictionary entry for qi gives the pronunciation as IPA (tʃi), the etymology from Chinese "air; breath", and a definition of "The physical life-force postulated by certain Chinese philosophers; the material principle." It also gives eight usage examples, with the first recorded example of k'í in 1850 (The Chinese Repository),[note 1] of ch'i in 1917 (The Encyclopaedia Sinica),[note 2] and qi in 1971 (Felix Mann's Acupuncture)[note 3]

Concept

References to concepts analogous to qi are found in many Asian belief systems. Philosophical conceptions of qi from the earliest records of Chinese philosophy (5th century BCE) correspond to Western notions of humours, the ancient Hindu yogic concept of prana, and the traditional Jewish concept of nefesh.[13] An early form of qi comes from the writings of the Chinese philosopher Mencius (4th century BCE).
Within the framework of Chinese thought, no notion may attain such a degree of abstraction from empirical data as to correspond perfectly to one of our modern universal concepts. Nevertheless, the term qi comes as close as possible to constituting a generic designation equivalent to our word "energy". When Chinese thinkers are unwilling or unable to fix the quality of an energetic phenomenon, the character qi (氣) inevitably flows from their brushes.
— Manfred Porkert[14][page needed]
The ancient Chinese described qi as "life force". They believed it permeated everything and linked their surroundings together. Qi was also linked to the flow of energy around and through the body, forming a cohesive functioning unit. By understanding the rhythm and flow of qi, they believed they could guide exercises and treatments to provide stability and longevity.

Although the concept has been important within many Chinese philosophies, over the centuries the descriptions of qi have varied and have sometimes been in conflict. Until China came into contact with Western scientific and philosophical ideas, the Chinese had not categorized all things in terms of matter and energy. Qi and li (理: "pattern") were 'fundamental' categories similar to matter and energy.

Fairly early on[when?], some Chinese thinkers began to believe that there were different fractions of qi—the coarsest and heaviest fractions formed solids, lighter fractions formed liquids, and the most ethereal fractions were the "lifebreath" that animated living beings.[15] Yuán qì is a notion of innate or prenatal qi which is distinguished from acquired qi that a person may develop over their lifetime.

Philosophical roots

The earliest texts that speak of qi give some indications of how the concept developed. In the Analects of Confucius qi could mean "breath".[16] Combining it with the Chinese word for blood (making 血氣, xueqi, blood and breath), the concept could be used to account for motivational characteristics:
The [morally] noble man guards himself against 3 things. When he is young, his xueqi has not yet stabilized, so he guards himself against sexual passion. When he reaches his prime, his xueqi is not easily subdued, so he guards himself against combativeness. When he reaches old age, his xueqi is already depleted, so he guards himself against acquisitiveness.
— Confucius, Analects, 16:7
The philosopher Mozi used the word qi to refer to noxious vapors that would in eventually arise from a corpse were it not buried at a sufficient depth.[17] He reported that early civilized humans learned how to live in houses to protect their qi from the moisture that troubled them when they lived in caves.[17] He also associated maintaining one's qi with providing oneself with adequate nutrition.[17] In regard to another kind of qi, he recorded how some people performed a kind of prognostication by observing qi (clouds) in the sky.[17]

Mencius described a kind of qi that might be characterized as an individual's vital energies. This qi was necessary to activity and it could be controlled by a well-integrated willpower. When properly nurtured, this qi was said to be capable of extending beyond the human body to reach throughout the universe.[18] It could also be augmented by means of careful exercise of one's moral capacities.[18] On the other hand, the qi of an individual could be degraded by adverse external forces that succeed in operating on that individual.[18]

Living things were not the only things believed to have qi. Zhuangzi indicated that wind is the qi of the Earth.[19] Moreover, cosmic yin and yang "are the greatest of qi".[19] He described qi as "issuing forth" and creating profound effects.[19] He also said "Human beings are born [because of] the accumulation of qi. When it accumulates there is life. When it dissipates there is death... There is one qi that connects and pervades everything in the world."[19]

Another passage traces life to intercourse between Heaven and Earth: "The highest Yin is the most restrained. The highest Yang is the most exuberant. The restrained comes forth from Heaven. The exuberant issues forth from Earth. The two intertwine and penetrate forming a harmony, and [as a result] things are born."[19]

The Guanzi essay Neiye (Inward Training) is the oldest received writing on the subject of the cultivation of vapor [qi] and meditation techniques. The essay was probably composed at the Jixia Academy in Qi in the late fourth century B.C.[20]

Xun Zi, another Confucian scholar of the Jixia Academy, followed in later years. At 9:69/127, Xun Zi says, "Fire and water have qi but do not have life. Grasses and trees have life but do not have perceptivity. Fowl and beasts have perceptivity but do not have yi (sense of right and wrong, duty, justice). Men have qi, life, perceptivity, and yi." Chinese people at such an early time had no concept of radiant energy, but they were aware that one can be heated by a campfire from a distance away from the fire. They accounted for this phenomenon by claiming "qi" radiated from fire. At 18:62/122, he also uses "qi" to refer to the vital forces of the body that decline with advanced age.

Among the animals, the gibbon and the crane were considered experts at inhaling the qi. The Confucian scholar Dong Zhongshu (ca. 150 BC) wrote in Luxuriant Dew of the Spring and Autumn Annals:[21] "The gibbon resembles a macaque, but he is larger, and his color is black. His forearms being long, he lives eight hundred years, because he is expert in controlling his breathing." ("猿似猴。大而黑。長前臂。所以壽八百。好引氣也。")

Later, the syncretic text assembled under the direction of Liu An, the Huai Nan Zi, or "Masters of Huainan", has a passage that presages most of what is given greater detail by the Neo-Confucians:
Heaven (seen here as the ultimate source of all being) falls (duo 墮, i.e., descends into proto-immanence) as the formless. Fleeting, fluttering, penetrating, amorphous it is, and so it is called the Supreme Luminary. The dao begins in the Void Brightening. The Void Brightening produces the universe (yuzhou). The universe produces qi. Qi has bounds. The clear, yang [qi] was ethereal and so formed heaven. The heavy, turbid [qi] was congealed and impeded and so formed earth. The conjunction of the clear, yang [qi] was fluid and easy. The conjunction of the heavy, turbid [qi] was strained and difficult. So heaven was formed first and earth was made fast later. The pervading essence (xijing) of heaven and earth becomes yin and yang. The concentrated (zhuan) essences of yin and yang become the four seasons. The dispersed (san) essences of the four seasons become the myriad creatures. The hot qi of yang in accumulating produces fire. The essence (jing) of the fire-qi becomes the sun. The cold qi of yin in accumulating produces water. The essence of the water-qi becomes the moon. The essences produced by coitus (yin) of the sun and moon become the stars and celestial markpoints (chen, planets).
— Huai-nan-zi, 3:1a/19

Role in traditional Chinese medicine

The Huangdi Neijing ("The Yellow Emperor's Classic of Medicine", circa 2nd century BCE) is historically credited with first establishing the pathways, called meridians, through which qi circulates in the human body.[22][23][page needed][24][ISBN missing]

In traditional Chinese medicine, symptoms of various illnesses are believed to be either the product of disrupted, blocked, and unbalanced qi movement through meridians or deficiencies and imbalances of qi in the Zang Fu organs.[24] Traditional Chinese medicine often seeks to relieve these imbalances by adjusting the circulation of qi using a variety of techniques including herbology, food therapy, physical training regimens (qigong, t'ai chi ch'uan, and other martial arts training),[25][page needed] moxibustion, tui na, or acupuncture.[24]:78

The nomenclature of Qi in the human body is different depending on its sources, roles, and locations[26]. For sources there is a difference between so-called "Primordial Qi" (acquired at birth from one's parents) and Qi acquired throughout one's life[26]. Or again Chinese medicine differentiates between Qi acquired from the air we breathe (so called "Clean Air") and Qi acquired from food and drinks (so-called "Grain Qi"). Looking at roles Qi is divided into "Defensive Qi" and "Nutritive Qi"[26]. Defensive Qi's role is to defend the body against invasions while Nutritive Qi's role is to provide sustenance for the body. Lastly, looking at locations, Qi is also named after the Zang-Fu organ or the Meridian in which it resides[26]: "Liver Qi", "Spleen Qi", etc.

A qi field (chu-chong) refers to the cultivation of an energy field by a group, typically for healing or other benevolent purposes. A qi field is believed to be produced by visualization and affirmation. They are an important component of Wisdom Healing'Qigong (Zhineng Qigong), founded by Grandmaster Ming Pang.

Comparable concepts

Concepts similar to qi can be found in many cultures.

Religious beliefs

Prana in Hinduism and Indian culture, chi in the Igbo religion, pneuma in ancient Greece, mana in Hawaiian culture, lüng in Tibetan Buddhism, manitou in the culture of the indigenous peoples of the Americas, ruah in Jewish culture. In Western philosophy, notions of energeia, élan vital, or vitalism are purported to be similar.[30]

Some elements of the qi concept can be found in the term 'energy' when used in the context of various esoteric forms of spirituality and alternative medicine.[citation needed]

Popular culture

Elements of the concept of Qi can also be found in Eastern and Western popular culture:

Scientific view

Qi is a non-scientific, unverifiable concept.[4]

A 1997 consensus statement on acupuncture by the United States National Institutes of Health noted that concepts such as qi "are difficult to reconcile with contemporary biomedical information".[33]

The 2014 Skeptoid podcast episode titled "Your Body's Alleged Energy Fields" related a Reiki practitioner's report of what was happening as she passed her hands over a subject's body:
What we'll be looking for here, within John's auric field, is any areas of intense heat, unusual coldness, a repelling energy, a dense energy, a magnetizing energy, tingling sensations, or actually the body attracting the hands into that area where it needs the reiki energy, and balancing of John's qi.[5]
Evaluating these claims, author and scientific skeptic Brian Dunning reported:
...his aura, his qi, his reiki energy. None of these have any counterpart in the physical world. Although she attempted to describe their properties as heat or magnetism, those properties are already taken by – well, heat and magnetism. There are no properties attributable to the mysterious field she describes, thus it cannot be authoritatively said to exist.[5]

Practices involving qi

Feng shui

The traditional Chinese art of geomancy, the placement and arrangement of space called feng shui, is based on calculating the balance of qi, interactions between the five elements, yin and yang, and other factors. The retention or dissipation of qi is believed to affect the health, wealth, energy level, luck, and many other aspects of the occupants. Attributes of each item in a space affect the flow of qi by slowing it down, redirecting it or accelerating it. This is said to influence the energy level of the occupants.
One use for a luopan is to detect the flow of qi.[34] The quality of qi may rise and fall over time. Feng shui with a compass might be considered a form of divination that assesses the quality of the local environment.

Qigong

Qìgōng (气功 or 氣功) involves coordinated breathing, movement, and awareness. It is traditionally viewed as a practice to cultivate and balance qi. With roots in traditional Chinese medicine, philosophy and martial arts, qigong is now practiced worldwide for exercise, healing, meditation, and training for martial arts. Typically a qigong practice involves rhythmic breathing, slow and stylized movement, a mindful state, and visualization of guiding qi.[35][page needed][36][37][page needed]

Martial arts

Qi is a didactic concept in many Chinese, Korean and Japanese martial arts. Martial qigong is a feature of both internal and external training systems in China[38][page needed] and other East Asian cultures.[39][page needed] The most notable of the qi-focused "internal" force (jin) martial arts are Baguazhang, Xing Yi Quan, T'ai Chi Ch'uan, Southern Praying Mantis, Snake Kung Fu, Southern Dragon Kung Fu, Aikido, Kendo, Hapkido, Aikijujutsu, Luohan Quan, and Liu He Ba Fa.
Demonstrations of qi or ki are popular in some martial arts and may include the unraisable body, the unbendable arm, and other feats of power. Some of these feats can alternatively be explained using biomechanics and physics.[40]

Acupuncture and moxibustion

Acupuncture is a part of traditional Chinese medicine that involves insertion of needles into superficial structures of the body (skin, subcutaneous tissue, muscles) at acupuncture points to balance the flow of qi. This is often accompanied by moxibustion, a treatment that involves burning mugwort on or near the skin at an acupuncture point.

Tuesday, July 3, 2018

Essay | How to make space great again

December 15, 2016
By Brent Ziarnick, Peter Garretson, Everett Dolman, and Coyote Smith
Original link:  http://www.kurzweilai.net/heres-how-to-make-space-great-again

(Credit: NASA Innovative Advanced Concepts)

Nowhere can dreams be more inspiring and profitable than in space. But today, expanding space enterprise is not foremost on the minds of Americans or military strategists. As a recent CNN special showed, defense thinkers feel embattled in space, focused on protecting our existing investments rather than developing new ones that seize strategic advantage.

Major Brent Ziarnick, Lieutenant Colonel Peter Garretson, Everett Dolman, and Coyote Smith are members of the United States Air Force’s Space Horizons team. Space Horizons is a research group chartered by the Air University to explore the future of American space activity. The opinions herein are those of the authors alone and are not necessarily the views of Air University, the U.S. Air Force, or the U.S. government.

The first step to make space great again is for the United States to offer a constructive vision that can satisfy many American space needs, including defense. The Trump administration has an opportunity to transcend pessimism in space and focus America where it thrives: aggressive yet peaceful competition. Interested readers can view our complete recommendations, but a new Trump national space policy should declare:

The U.S. will be the first nation to mine an asteroid. The trillions of dollars in mineral wealth from asteroids can fuel a vibrant in-space economy capable of lifting up all humankind. America must lead this process.

The U.S. will be the first nation to extract resources from Earth’s moon to operate a commercial transportation service to and from the lunar surface. Our moon offers vast resources and tremendous logistical advantages for the development of that in-space economy. The U.S. will conduct research and establish public-private partnerships to advance the technology and the development of self-sustaining commercial services. The U.S. should also commit to being an early customer of such services, and it should take a leadership role in helping private industry develop businesses based on lunar exploration.

The U.S. will be the first nation to operate a propellant depot and on-orbit refueling service. Being able to refuel on orbit is key to an agile and fully reusable space transportation system. The United States will be the first to prove this technology and offer it as a commercial service to others.

The U.S. will be the first nation to operate a private space station. A thriving space economy must provide broad, affordable access to space across society, and it must have ordinary citizens living and working there permanently. As someone deeply knowledgeable about the hotel industry, the president-elect might understand the value of a U.S.-branded orbital tower.

The U.S. will operate the first fleet of fully reusable launch vehicles. Central to assured access for our citizenry is the ability to come and go to space with aircraft-like operations. A fully reusable architecture, technically feasible but never championed by the government, makes private spaceflight and even greater projects possible. America will provide the transportation system that fuels the larger global ecosystem of innovation.

The U.S. will build the first profitable solar power satellite. No single innovation in space could be as transformational as unlocking the vast potential of space-based solar energy generation to power Earth’s electrical needs; that could provide the hundreds of terawatts of renewable energy necessary to provide first-world living standards to the entire planet in a green and environmentally sustainable manner. The logistics system to create this space-power grid would require moving millions of metric tons of satellites to geostationary orbit and, consequently, will be orders of magnitude larger than any envisioned government-centric space program.

The U.S. will build the first comprehensive system to defend Earth from hazardous asteroids and comets. This planetary defense capability will initially start small, providing adequate defense against both 50-meter and 300-meter diameter objects with years of advance warning, and be built to provide comprehensive protection against extinction-level events. The United States will design, construct, and seek to test this capability in the current administration, and aim to maintain a standby global defense capability soon thereafter.

The U.S. will fly the first mission to another star. Interstellar spaceflight will be the ultimate expression of humanity mastering space travel. The American people must be the first to be ready.

This list of goals sounds audacious, perhaps outrageous, but it is entirely within the capability and character of the people who built the Transcontinental Railroad, the Hoover Dam, and conquered a continent. Americans are leaders in every one of these fields. It is only necessary for the new President to unleash America’s potential — once unleashed, American innovators will move these dreams toward reality faster than anyone can imagine.

Opioid peptide

From Wikipedia, the free encyclopedia
 
Vertebrate endogenous opioids neuropeptide
Identifiers
Symbol Opiods_neuropep
Pfam PF01160
InterPro IPR006024
PROSITE PDOC00964
Structural correlation between met-enkephalin, an opioid peptide, (left) and morphine, an opiate drug, (right)

Opioid peptides are peptides that bind to opioid receptors in the brain; opiates and opioids mimic the effect of these peptides. Such peptides may be produced by the body itself, for example endorphins. The effects of these peptides vary, but they all resemble those of opiates. Brain opioid peptide systems are known to play an important role in motivation, emotion, attachment behaviour, the response to stress and pain, and the control of food intake.

Opioid-like peptides may also be absorbed from partially digested food (casomorphins, exorphins, and rubiscolins). The opioid food peptides have lengths of typically 4–8 amino acids. The body's own opioids are generally much longer.

Opioid peptides are released by post-translational proteolytic cleavage of precursor proteins. The precursors consist of the following components: a signal sequence that precedes a conserved region of about 50 residues; a variable-length region; and the sequence of the neuropeptides themselves. Sequence analysis reveals that the conserved N-terminal region of the precursors contains 6 cysteines, which are probably involved in disulfide bond formation. It is speculated that this region might be important for neuropeptide processing.[1]

Endogenous opioids produced in the body

The human genome contains several homologous genes that are known to code for endogenous opioid peptides.
While not peptides, codeine and morphine are also produced in the human body.[6][7]
Endogenous opioid peptides and their receptors
 
Opioid peptide Amino acid sequence Opioid receptor target(s) References
Enkephalins
Leu-enkephalin YGGFL δ-opioid receptor, μ-opioid receptor [8][9][10]
Met-enkephalin YGGFM δ-opioid receptor, μ-opioid receptor [8][9][10]
Metorphamide YGGFMRRV-NH2 δ-opioid receptor, μ-opioid receptor [8]
Peptide E YGGFMRRVGRPEWWMDYQKRYGGFL μ-opioid receptor, κ-opioid receptor [8]
Endorphins
α-Endorphin YGGFMTSEKSQTPLVT μ-opioid receptor, unknown affinity for other opioid receptors [8]
β-Endorphin YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE μ-opioid receptor'†', δ-opioid receptor [8][9][10][7]
γ-Endorphin YGGFMTSEKSQTPLVTL μ-opioid receptor, unknown affinity for other opioid receptors [8]
Dynorphins
Dynorphin A YGGFLRRIRPKLKWDNQ κ-opioid receptor'†' [8][9][11]
Dynorphin A1–8 YGGFLRRI κ-opioid receptor, μ-opioid receptor (partial agonist at δ-opioid receptor) [12][13]
Dynorphin B YGGFLRRQFKVVT κ-opioid receptor [8][9]
Big dynorphin YGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVT κ-opioid receptor'†' [11][14][15]
Leumorphin YGGFLRRQFKVVTRSQEDPNAYYEELFDV κ-opioid receptor [16][17][18][19]
α-Neoendorphin YGGFLRKYPK κ-opioid receptor [8][9]
β-Neoendorphin YGGFLRKYP κ-opioid receptor [8]
Nociceptin
Nociceptin FGGFTGARKSARKLANQ nociceptin receptor'†' [8][9][20]
Endomorphins
Endomorphin-1 YPWF-NH2 μ-opioid receptor [8][9]
Endomorphin-2 YPFF-NH2 μ-opioid receptor [8][9]
This symbol next to a receptor indicates that the corresponding peptide is a principal endogenous agonist of the receptor in humans.
This symbol next to a receptor indicates that the corresponding peptide is the endogenous ligand with the highest known potency for the receptor in humans.

Opioid food peptides

Exogenous opioid substances are called exorphins, as opposed to endorphines. Exorphins include opioid food peptides like Gluten exorphin and opioid food peptides and are mostly contained in cereals and animal milk. They mimic the actions of endorphines because they bind to the same opioid receptors in the brain.

These are the most common exorphins:

Amphibian opioid peptides

Synthetic opioid peptides

Human Body Version 2.0

February 16, 2003 by Ray Kurzweil
Original link:  http://www.kurzweilai.net/human-body-version-20

In the coming decades, a radical upgrading of our body’s physical and mental systems, already underway, will use nanobots to augment and ultimately replace our organs. We already know how to prevent most degenerative disease through nutrition and supplementation; this will be a bridge to the emerging biotechnology revolution, which in turn will be a bridge to the nanotechnology revolution. By 2030, reverse-engineering of the human brain will have been completed and nonbiological intelligence will merge with our biological brains.

Sex has already been largely separated from its biological function. For the most part, we engage in sexual activity for intimate communication and sensual pleasure, not reproduction. Conversely, we have multiple methodologies for creating babies without physical sex, albeit most reproduction still does derive from the sex act. Although not condoned by all sectors of society, this disentanglement of sex from its biological function has been readily, even eagerly, adopted by the mainstream.

So why don’t we provide the same extrication of purpose from biology for another activity that also provides both social intimacy and sensual pleasure, namely eating? We have crude ways of doing this today. Starch blockers, such as Bayer’s Precose, partially prevent absorption of complex carbohydrates; fat blockers, such as Chitosan, bind to fat molecules, causing them to pass through the digestive tract; and sugar substitutes, such as Sucralose and Stevia, provide sweetness without calories. There are limitations and problems with each of these contemporary technologies, but a more effective generation of drugs is being developed that will block excess caloric absorption on the cellular level.

Let us consider, however, a more fundamental reengineering of the digestive process to disconnect the sensual aspects of eating from its original biological purpose: to provide nutrients into the bloodstream that are then delivered to each of our trillions of cells. These nutrients include caloric (energy-bearing) substances such as glucose (from carbohydrates), proteins, fats, and a myriad of trace molecules, such as vitamins, minerals, and phytochemicals, that provide building blocks and facilitating enzymes for diverse metabolic processes.

An Era of Abundance

Our knowledge of the complex pathways underlying digestive processes is rapidly expanding, although there is still a great deal we do not fully understand. On the one hand, digestion, like any other major human biological system, is astonishing in its intricacy and cleverness. Our bodies manage to extract the complex resources needed to survive, despite sharply varying conditions, while at the same time, filtering out a multiplicity of toxins.

On the other hand, our bodies evolved in a very different era. Our digestive processes in particular are optimized for a situation that is dramatically dissimilar to the one we find ourselves in. For most of our biological heritage, there was a high likelihood that the next foraging or hunting season (and for a brief, relatively recent period, the next planting season) might be catastrophically lean. So it made sense for our bodies to hold on to every possible calorie. Today, this biological strategy is extremely counterproductive. Our outdated metabolic programming underlies our contemporary epidemic of obesity and fuels pathological processes of degenerative disease such as coronary artery disease, and type II diabetes.

Up until recently (on an evolutionary time scale), it was not in the interest of the species for old people like myself (I was born in 1948) to use up the limited resources of the clan. Evolution favored a short life span—life expectancy was 37 years only two centuries ago—so these restricted reserves could be devoted to the young, those caring for them, and those strong enough to perform intense physical work.

We now live in an era of great material abundance. Most work requires mental effort rather than physical exertion. A century ago, 30 percent of the U.S. work force worked on farms, with another 30 percent deployed in factories. Both of these figures are now under 3 percent. The significant majority of today’s job categories, ranging from airline flight attendant to web designer, simply didn’t exist a century ago. Circa 2003, we have the opportunity to continue to contribute to our civilization’s exponentially growing knowledge base—incidentally, a unique attribute of our species—well past our child-rearing days.

Our species has already augmented the “natural” order of our life cycle through our technology: drugs, supplements, replacement parts for virtually all bodily systems, and many other interventions. We already have devices to replace our hips, knees, shoulders, elbows, wrists, jaws, teeth, skin, arteries, veins, heart valves, arms, legs, feet, fingers, and toes. Systems to replace more complex organs (for example, our hearts) are beginning to work. As we’re learning the principles of operation of the human body and the brain, we will soon be in a position to design vastly superior systems that will be more enjoyable, last longer, and perform better, without susceptibility to breakdown, disease, and aging.

Artist and cultural catalyst Natasha Vita-More pioneered a conceptual design for one such system, called Primo Posthuman, designed for mobility, flexibility and superlongevity. It features innovations such as a metabrain for global-net connection with prosthetic neo-neocortex of AI interwoven with nanobots; smart skin that is solar protected with biosensors for tone and texture changeability, and high-acuity senses.


Introducing Human Body Version 2.0

We won’t engineer human body version 2.0 all at once. It will be an incremental process, one already well under way. Although version 2.0 is a grand project, ultimately resulting in the radical upgrading of all our physical and mental systems, we will implement it one benign step at a time. Based on our current knowledge, we can already touch and feel the means for accomplishing each aspect of this vision.

From this perspective, let’s return to a consideration of the digestive system. We already have a reasonably comprehensive picture of the constituent ingredients of the food we eat. We already have the means to survive without eating, using intravenous nutrition (for people who are unable to eat), although this is clearly not a pleasant process, given the current limitations in our technologies for getting substances in and out of the blood stream.

The next phase of improvement will be largely biochemical, in the form of drugs and supplements that will block excess caloric absorption and otherwise reprogram metabolic pathways for optimal health. We already have the knowledge to prevent most instances of degenerative disease, such as heart disease, stroke, type II diabetes, and cancer, through comprehensive programs of nutrition and supplementation, something which I personally do, and will describe in an upcoming book (A Short Guide to a Long Life, coauthored with Terry Grossman, M.D.). I view our current knowledge as a bridge to the full flowering of the biotechnology revolution, which in turn will be a bridge to the nanotechnology revolution.

It’s All About Nanobots

In a famous scene from the movie, The Graduate, Benjamin’s mentor gives him career advice in a single word: “plastics.” Today, that word might be “software,” or “biotechnology,” but in another couple of decades, the word is likely to be “nanobots.” Nanobots—blood-cell-sized robots—will provide the means to radically redesign our digestive systems, and, incidentally, just about everything else.

In an intermediate phase, nanobots in the digestive tract and bloodstream will intelligently extract the precise nutrients we need, call for needed additional nutrients and supplements through our personal wireless local area network, and send the rest of the food we eat on its way to be passed through for elimination.

If this seems futuristic, keep in mind that intelligent machines are already making their way into our blood stream. There are dozens of projects underway to create blood-stream-based “biological microelectromechanical systems” (bioMEMS) with a wide range of diagnostic and therapeutic applications. BioMEMS devices are being designed to intelligently scout out pathogens and deliver medications in very precise ways.

For example, a researcher at the University of Illinois at Chicago has created a tiny capsule with pores measuring only seven nanometers. The pores let insulin out in a controlled manner but prevent antibodies from invading the pancreatic Islet cells inside the capsule. These nanoengineered devices have cured rats with type I diabetes, and there is no reason that the same methodology would fail to work in humans. Similar systems could precisely deliver dopamine to the brain for Parkinson’s patients, provide blood-clotting factors for patients with hemophilia, and deliver cancer drugs directly to tumor sites. A new design provides up to 20 substance-containing reservoirs that can release their cargo at programmed times and locations in the body.

Kensall Wise, a professor of electrical engineering at the University of Michigan, has developed a tiny neural probe that can provide precise monitoring of the electrical activity of patients with neural diseases. Future designs are expected to also deliver drugs to precise locations in the brain. Kazushi Ishiyama at Tohoku University in Japan has developed micromachines that use microscopic-sized spinning screws to deliver drugs to small cancer tumors.

A particularly innovative micromachine developed by Sandia National Labs has actual microteeth with a jaw that opens and closes to trap individual cells and then implant them with substances such as DNA, proteins or drugs. There are already at least four major scientific conferences on bioMEMS and other approaches to developing micro- and nano-scale machines to go into the body and bloodstream.

Ultimately, the individualized nutrients needed for each person will be fully understood (including all the hundreds of phytochemicals) and easily and inexpensively available, so we won’t need to bother with extracting nutrients from food at all. Just as we routinely engage in sex today for its relational and sensual gratification, we will gain the opportunity to disconnect the eating of food from the function of delivering nutrients into the bloodstream.

This technology should be reasonably mature by the 2020s. Nutrients will be introduced directly into the bloodstream by special metabolic nanobots. Sensors in our bloodstream and body, using wireless communication, will provide dynamic information on the nutrients needed at each point in time.

A key question in designing this technology will be the means by which these nanobots make their way in and out of the body. As I mentioned above, the technologies we have today, such as intravenous catheters, leave much to be desired. A significant benefit of nanobot technology is that unlike mere drugs and nutritional supplements, nanobots have a measure of intelligence. They can keep track of their own inventories, and intelligently slip in and out of our bodies in clever ways. One scenario is that we would wear a special “nutrient garment” such as a belt or undershirt. This garment would be loaded with nutrient bearing nanobots, which would make their way in and out of our bodies through the skin or other body cavities.

At this stage of technological development, we will be able to eat whatever we want, whatever gives us pleasure and gastronomic fulfillment, and thereby unreservedly explore the culinary arts for their tastes, textures, and aromas. At the same time, we will provide an optimal flow of nutrients to our bloodstream, using a completely separate process. One possibility would be that all the food we eat would pass through a digestive tract that is now disconnected from any possible absorption into the bloodstream.

This would place a burden on our colon and bowel functions, so a more refined approach will dispense with the function of elimination. We will be able to accomplish this using special elimination nanobots that act like tiny garbage compactors. As the nutrient nanobots make their way from the nutrient garment into our bodies, the elimination nanobots will go the other way. Periodically, we would replace the nutrition garment for a fresh one. One might comment that we do obtain some pleasure from the elimination function, but I suspect that most people would be happy to do without it.

Ultimately we won’t need to bother with special garments or explicit nutritional resources. Just as computation will eventually be ubiquitous and available everywhere, so too will basic metabolic nanobot resources be embedded everywhere in our environment. In addition, an important aspect of this system will be maintaining ample reserves of all needed resources inside the body. Our version 1.0 bodies do this to only a very limited extent, for example, storing a few minutes of oxygen in our blood, and a few days of caloric energy in glycogen and other reserves. Version 2.0 will provide substantially greater reserves, enabling us to be separated from metabolic resources for greatly extended periods of time.

Once perfected, we will no longer need version 1.0 of our digestive system at all. I pointed out above that our adoption of these technologies will be cautious and incremental, so we will not dispense with the old-fashioned digestive process when these technologies are first introduced. Most of us will wait for digestive system version 2.1 or even 2.2 before being willing to do dispense with version 1.0. After all, people didn’t throw away their typewriters when the first generation of word processors was introduced. People held onto their vinyl record collections for many years after CDs came out (I still have mine). People are still holding onto their film cameras, although the tide is rapidly turning in favor of digital cameras.

However, these new technologies do ultimately dominate, and few people today still own a typewriter. The same phenomenon will happen with our reengineered bodies. Once we’ve worked out the inevitable complications that will arise with a radically reengineered gastrointestinal system, we will begin to rely on it more and more.

Programmable Blood

As we reverse-engineer (learn the principles of operation of) our various bodily systems, we will be in a position to engineer new systems that provide dramatic improvements. One pervasive system that has already been the subject of a comprehensive conceptual redesign is our blood.

One of the leading proponents of “nanomedicine,” (redesigning our biological systems through engineering on a molecular scale) and author of a book with the same name is Robert Freitas, Research Scientist at nanotechnology firm Zyvex Corp. Freitas’ ambitious manuscript is a comprehensive road map to rearchitecting our biological heritage. One of Freitas’ designs is to replace (or augment) our red blood cells with artificial “respirocytes” that would enable us to hold our breath for four hours or do a top-speed sprint for 15 minutes without taking a breath. Like most of our biological systems, our red blood cells perform their oxygenating function very inefficiently, and Freitas has redesigned them for optimal performance. He has worked out many of the physical and chemical requirements in impressive detail.

It will be interesting to see how this development is dealt with in athletic contests. Presumably, the use of respirocytes and similar systems will be prohibited from Olympic contests, but then we will have the specter of teenagers in junior high school gymnasiums routinely outperforming Olympic athletes.

Freitas envisions micron-size artificial platelets that could achieve hemostasis (bleeding control) up to 1,000 times faster than biological platelets. Freitas describes nanorobotic microbivores (white blood cell replacements) that will download software to destroy specific infections hundreds of times faster than antibiotics, and that will be effective against all bacterial, viral and fungal infections, with no limitations of drug resistance.

I’ve personally watched (through a microscope) my own white blood cells surround and devour a pathogen, and I was struck with the remarkable sluggishness of this natural process. Although replacing our blood with billions of nanorobotic devices will require a lengthy process of development, refinement, and regulatory approval, we already have the conceptual knowledge to engineer substantial improvements over the remarkable but very inefficient methods used in our biological bodies.

Have a Heart, or Not

The next organ on my hit list is the heart. It’s a remarkable machine, but it has a number of severe problems. It is subject to a myriad of failure modes, and represents a fundamental weakness in our potential longevity. The heart usually breaks down long before the rest of the body, and often very prematurely.

Although artificial hearts are beginning to work, a more effective approach will be to get rid of the heart altogether. Among Freitas’ designs are nanorobotic blood cell replacements that provide their own mobility. If the blood system moves with its own movement, the engineering issues of the extreme pressures required for centralized pumping can be eliminated. As we perfect the means of transferring nanobots to and from the blood supply, we can also continuously replace the nanobots comprising our blood supply.

Energy will be provided by microscopic-sized hydrogen fuel cells. Integrated Fuel Cell Technologies, one of many companies pioneering fuel cell technology, has already created microscopic-sized fuel cells. Their first-generation design provides tens of thousands of fuel cells on an integrated circuit and is intended to power portable electronics.

With the respirocytes providing greatly extended access to oxygenation, we will be in a position to eliminate the lungs by using nanobots to provide oxygen and remove carbon dioxide. One might point out that we take pleasure in breathing (even more so than elimination!). As with all of these redesigns, we will certainly go through intermediate stages where these technologies augment our natural systems, so we can have the best of both worlds. Eventually, however, there will be no reason to continue with the complications of actual breathing and the requirement of having breathable air everywhere we go. If we really find breathing that pleasurable, we will develop virtual ways of having this sensual experience.

We also won’t need the various organs that produce chemicals, hormones, and enzymes that flow into the blood and other metabolic pathways. We already create bio-identical versions of many of these substances, and we will have the means to routinely create all biochemically relevant substances within a couple of decades. These substances (to the extent that we still need them) will be delivered via nanobots, controlled by intelligent biofeedback systems to maintain and balance required levels, just as our “natural” systems do today (for example, the control of insulin levels by the pancreatic Islet cells). Since we are eliminating most of our biological organs, many of these substances may no longer be needed, and will be replaced by other resources that are required by the nanorobotic systems.

Similarly the organs that filter the blood for impurities, such as the kidneys, can also be replaced by nanorobot-based elimination services.

It is important to emphasize that this redesign process will not be accomplished in a single design cycle. Each organ and each idea will have its own progression, intermediate designs, and stages of implementation. Nonetheless, we are clearly headed towards a fundamental and radical redesign of the extremely inefficient and limited functionality of human body version 1.0.

So What’s Left?

Let’s consider where we are. We’ve eliminated the heart, lungs, red and white blood cells, platelets, pancreas, thyroid and all the hormone-producing organs, kidneys, bladder, liver, lower esophagus, stomach, small intestines, large intestines, and bowel. What we have left at this point is the skeleton, skin, sex organs, mouth and upper esophagus, and brain.

The skeleton is a stable structure, and we already have a reasonable understanding of how it works. We replace parts of it today, although our current technology for doing this has severe limitations. Interlinking nanobots will provide the ability to augment and ultimately replace the skeleton. Replacing portions of the skeleton today requires painful surgery, but replacing it through nanobots from within can be a gradual and noninvasive process. The human skeleton version 2.0 will very strong, stable, and self repairing.

We will not notice the absence of many of our organs, such as the liver and pancreas, as we do not directly experience their functionality. The skin, however, is an organ we will actually want to keep, or at least we will want to maintain its functionality. The skin, which includes our primary and secondary sex organs, provides a vital function of communication and pleasure. Nonetheless, we will ultimately be able to improve on the skin with new nanoengineered supple materials that will provide greater protection from physical and thermal environmental effects while enhancing our capacity for intimate communication and pleasure. The same observation holds for the mouth and upper esophagus, which comprise the remaining aspects of the digestive system that we use to experience the act of eating.

Redesigning the Human Brain

The process of reverse engineering and redesign will also encompass the most important system in our bodies: the brain. The brain is at least as complex as all the other organs put together, with approximately half of our genetic code devoted to its design. It is a misconception to regard the brain as a single organ. It is actually an intricate collection of information-processing organs, interconnected in an elaborate hierarchy, as is the accident of our evolutionary history.

The process of understanding the principles of operation of the human brain is already well under way. The underlying technologies of brain scanning and neuron modeling are scaling up exponentially, as is our overall knowledge of human brain function. We already have detailed mathematical models of a couple dozen of the several hundred regions that comprise the human brain.

The age of neural implants is also well under way. We have brain implants based on “neuromorphic” modeling (i.e., reverse-engineering of the human brain and nervous system) for a rapidly growing list of brain regions. A friend of mine who became deaf while an adult can now engage in telephone conversations again because of his cochlear implant, a device that interfaces directly with the auditory nervous system. He plans to replace it with a new model with a thousand levels of frequency discrimination, which will enable him to hear music once again. He laments that he has had the same melodies playing in his head for the past 15 years and is looking forward to hearing some new tunes. A future generation of cochlear implants now on the drawing board will provide levels of frequency discrimination that go significantly beyond that of “normal” hearing.

Researchers at MIT and Harvard are developing neural implants to replace damaged retinas. There are brain implants for Parkinson’s patients that communicate directly with the ventral posterior nucleus and subthalmic nucleus regions of the brain to reverse the most devastating symptoms of this disease. An implant for people with cerebral palsy and multiple sclerosis communicates with the ventral lateral thalamus and has been effective in controlling tremors. “Rather than treat the brain like soup, adding chemicals that enhance or suppress certain neurotransmitters,” says Rick Trosch, an American physician helping to pioneer these therapies, “we’re now treating it like circuitry.”

A variety of techniques are being developed to provide the communications bridge between the wet analog world of biological information processing and digital electronics. Researchers at Germany’s Max Planck Institute have developed noninvasive devices that can communicate with neurons in both directions. They demonstrated their “neuron transistor” by controlling the movements of a living leech from a personal computer. Similar technology has been used to reconnect leech neurons and to coax them to perform simple logical and arithmetic problems. Scientists are now experimenting with a new design called “quantum dots,” which uses tiny crystals of semiconductor material to connect electronic devices with neurons.

These developments provide the promise of reconnecting broken neural pathways for people with nerve damage and spinal cord injuries. It has long been thought that recreating these pathways would only be feasible for recently injured patients because nerves gradually deteriorate when unused. A recent discovery, however, shows the feasibility of a neuroprosthetic system for patients with long-standing spinal cord injuries. Researchers at the University of Utah asked a group of long-term quadriplegic patients to move their limbs in a variety of ways and then observed the response of their brains, using magnetic resonance imaging (MRI). Although the neural pathways to their limbs had been inactive for many years, the pattern of their brain activity when attempting to move their limbs was very close to that observed in non-disabled persons.

We will, therefore, be able to place sensors in the brain of a paralyzed person (e.g., Christopher Reeve) that will be programmed to recognize the brain patterns associated with intended movements and then stimulate the appropriate sequence of muscle movements. For those patients whose muscles no longer function, there are already designs for “nanoelectromechanical” systems (NEMS) that can expand and contract to replace damaged muscles and that can be activated by either real or artificial nerves.

We Are Becoming Cyborgs

We are rapidly growing more intimate with our technology. Computers started out as large remote machines in air-conditioned rooms tended by white-coated technicians. Subsequently they moved onto our desks, then under our arms, and now in our pockets. Soon, we’ll routinely put them inside our bodies and brains. Ultimately we will become more nonbiological than biological.

The compelling benefits in overcoming profound diseases and disabilities will keep these technologies on a rapid course, but medical applications represent only the early adoption phase. As the technologies become established, there will be no barriers to using them for the expansion of human potential. In my view, expanding our potential is precisely the primary distinction of our species.

Moreover, all of the underlying technologies are accelerating. The power of computation has grown at a double exponential rate for all of the past century, and will continue to do so well into this century through the power of three-dimensional computing. Communication bandwidths and the pace of brain reverse-engineering are also quickening. Meanwhile, according to my models, the size of technology is shrinking at a rate of 5.6 per linear dimension per decade, which will make nanotechnology ubiquitous during the 2020s.

By the end of this decade, computing will disappear as a separate technology that we need to carry with us. We’ll routinely have high-resolution images encompassing the entire visual field written directly to our retinas from our eyeglasses and contact lenses (the Department of Defense is already using technology along these lines from Microvision, a company based in Bothell, Washington). We’ll have very-high-speed wireless connection to the Internet at all times. The electronics for all of this will be embedded in our clothing. Circa 2010, these very personal computers will enable us to meet with each other in full-immersion, visual-auditory, virtual-reality environments as well as augment our vision with location- and time-specific information at all times.

By 2030, electronics will utilize molecule-sized circuits, the reverse-engineering of the human brain will have been completed, and bioMEMS will have evolved into bioNEMS (biological nanoelectromechanical systems). It will be routine to have billions of nanobots (nano-scale robots) coursing through the capillaries of our brains, communicating with each other (over a wireless local area network), as well as with our biological neurons and with the Internet. One application will be to provide full-immersion virtual reality that encompasses all of our senses. When we want to enter a virtual-reality environment, the nanobots will replace the signals from our real senses with the signals that our brain would receive if we were actually in the virtual environment.

We will have a panoply of virtual environments to choose from, including earthly worlds that we are familiar with, as well as those with no earthly counterpart. We will be able to go to these virtual places and have any kind of interaction with other real (as well as simulated) people, ranging from business negotiations to sensual encounters. In virtual reality, we won’t be restricted to a single personality, since we will be able to change our appearance and become other people.

Experience Beamers

“Experience beamers” will beam their entire flow of sensory experiences as well as the neurological correlates of their emotional reactions out on the Web just as people today beam their bedroom images from their web cams. A popular pastime will be to plug in to someone else’s sensory-emotional beam and experience what it’s like to be someone else, à la the plot concept of the movie “Being John Malkovich.” There will also be a vast selection of archived experiences to choose from. The design of virtual environments and the creation of archived full-immersion experiences will become new art forms.

The most important application of circa-2030 nanobots will be to literally expand our minds. We’re limited today to a mere hundred trillion interneuronal connections; we will be able to augment these by adding virtual connections via nanobot communication. This will provide us with the opportunity to vastly expand our pattern recognition abilities, memories, and overall thinking capacity as well as directly interface with powerful forms of nonbiological intelligence.

It’s important to note that once nonbiological intelligence gets a foothold in our brains (a threshold we’ve already passed), it will grow exponentially, as is the accelerating nature of information-based technologies. A one-inch cube of nanotube circuitry (which is already working at smaller scales in laboratories) will be at least a million times more powerful than the human brain. By 2040, the nonbiological portion of our intelligence will be far more powerful than the biological portion. It will, however, still be part of the human-machine civilization, having been derived from human intelligence, i.e., created by humans (or machines created by humans) and based at least in part on the reverse-engineering of the human nervous system.

Stephen Hawking recently commented in the German magazine Focus that computer intelligence will surpass that of humans within a few decades. He advocated that we “develop as quickly as possible technologies that make possible a direct connection between brain and computer, so that artificial brains contribute to human intelligence rather than opposing it.” Hawking can take comfort that the development

program he is recommending is well under way.

© 2003 Ray Kurzweil.

Reflective programming

From Wikipedia, the free encyclopedia https://en.wikipedia.org/wiki/Reflecti...