Search This Blog

Tuesday, July 3, 2018

Essay | How to make space great again

December 15, 2016
By Brent Ziarnick, Peter Garretson, Everett Dolman, and Coyote Smith
Original link:  http://www.kurzweilai.net/heres-how-to-make-space-great-again

(Credit: NASA Innovative Advanced Concepts)

Nowhere can dreams be more inspiring and profitable than in space. But today, expanding space enterprise is not foremost on the minds of Americans or military strategists. As a recent CNN special showed, defense thinkers feel embattled in space, focused on protecting our existing investments rather than developing new ones that seize strategic advantage.

Major Brent Ziarnick, Lieutenant Colonel Peter Garretson, Everett Dolman, and Coyote Smith are members of the United States Air Force’s Space Horizons team. Space Horizons is a research group chartered by the Air University to explore the future of American space activity. The opinions herein are those of the authors alone and are not necessarily the views of Air University, the U.S. Air Force, or the U.S. government.

The first step to make space great again is for the United States to offer a constructive vision that can satisfy many American space needs, including defense. The Trump administration has an opportunity to transcend pessimism in space and focus America where it thrives: aggressive yet peaceful competition. Interested readers can view our complete recommendations, but a new Trump national space policy should declare:

The U.S. will be the first nation to mine an asteroid. The trillions of dollars in mineral wealth from asteroids can fuel a vibrant in-space economy capable of lifting up all humankind. America must lead this process.

The U.S. will be the first nation to extract resources from Earth’s moon to operate a commercial transportation service to and from the lunar surface. Our moon offers vast resources and tremendous logistical advantages for the development of that in-space economy. The U.S. will conduct research and establish public-private partnerships to advance the technology and the development of self-sustaining commercial services. The U.S. should also commit to being an early customer of such services, and it should take a leadership role in helping private industry develop businesses based on lunar exploration.

The U.S. will be the first nation to operate a propellant depot and on-orbit refueling service. Being able to refuel on orbit is key to an agile and fully reusable space transportation system. The United States will be the first to prove this technology and offer it as a commercial service to others.

The U.S. will be the first nation to operate a private space station. A thriving space economy must provide broad, affordable access to space across society, and it must have ordinary citizens living and working there permanently. As someone deeply knowledgeable about the hotel industry, the president-elect might understand the value of a U.S.-branded orbital tower.

The U.S. will operate the first fleet of fully reusable launch vehicles. Central to assured access for our citizenry is the ability to come and go to space with aircraft-like operations. A fully reusable architecture, technically feasible but never championed by the government, makes private spaceflight and even greater projects possible. America will provide the transportation system that fuels the larger global ecosystem of innovation.

The U.S. will build the first profitable solar power satellite. No single innovation in space could be as transformational as unlocking the vast potential of space-based solar energy generation to power Earth’s electrical needs; that could provide the hundreds of terawatts of renewable energy necessary to provide first-world living standards to the entire planet in a green and environmentally sustainable manner. The logistics system to create this space-power grid would require moving millions of metric tons of satellites to geostationary orbit and, consequently, will be orders of magnitude larger than any envisioned government-centric space program.

The U.S. will build the first comprehensive system to defend Earth from hazardous asteroids and comets. This planetary defense capability will initially start small, providing adequate defense against both 50-meter and 300-meter diameter objects with years of advance warning, and be built to provide comprehensive protection against extinction-level events. The United States will design, construct, and seek to test this capability in the current administration, and aim to maintain a standby global defense capability soon thereafter.

The U.S. will fly the first mission to another star. Interstellar spaceflight will be the ultimate expression of humanity mastering space travel. The American people must be the first to be ready.

This list of goals sounds audacious, perhaps outrageous, but it is entirely within the capability and character of the people who built the Transcontinental Railroad, the Hoover Dam, and conquered a continent. Americans are leaders in every one of these fields. It is only necessary for the new President to unleash America’s potential — once unleashed, American innovators will move these dreams toward reality faster than anyone can imagine.

Opioid peptide

From Wikipedia, the free encyclopedia
 
Vertebrate endogenous opioids neuropeptide
Identifiers
Symbol Opiods_neuropep
Pfam PF01160
InterPro IPR006024
PROSITE PDOC00964
Structural correlation between met-enkephalin, an opioid peptide, (left) and morphine, an opiate drug, (right)

Opioid peptides are peptides that bind to opioid receptors in the brain; opiates and opioids mimic the effect of these peptides. Such peptides may be produced by the body itself, for example endorphins. The effects of these peptides vary, but they all resemble those of opiates. Brain opioid peptide systems are known to play an important role in motivation, emotion, attachment behaviour, the response to stress and pain, and the control of food intake.

Opioid-like peptides may also be absorbed from partially digested food (casomorphins, exorphins, and rubiscolins). The opioid food peptides have lengths of typically 4–8 amino acids. The body's own opioids are generally much longer.

Opioid peptides are released by post-translational proteolytic cleavage of precursor proteins. The precursors consist of the following components: a signal sequence that precedes a conserved region of about 50 residues; a variable-length region; and the sequence of the neuropeptides themselves. Sequence analysis reveals that the conserved N-terminal region of the precursors contains 6 cysteines, which are probably involved in disulfide bond formation. It is speculated that this region might be important for neuropeptide processing.[1]

Endogenous opioids produced in the body

The human genome contains several homologous genes that are known to code for endogenous opioid peptides.
While not peptides, codeine and morphine are also produced in the human body.[6][7]
Endogenous opioid peptides and their receptors
 
Opioid peptide Amino acid sequence Opioid receptor target(s) References
Enkephalins
Leu-enkephalin YGGFL δ-opioid receptor, μ-opioid receptor [8][9][10]
Met-enkephalin YGGFM δ-opioid receptor, μ-opioid receptor [8][9][10]
Metorphamide YGGFMRRV-NH2 δ-opioid receptor, μ-opioid receptor [8]
Peptide E YGGFMRRVGRPEWWMDYQKRYGGFL μ-opioid receptor, κ-opioid receptor [8]
Endorphins
α-Endorphin YGGFMTSEKSQTPLVT μ-opioid receptor, unknown affinity for other opioid receptors [8]
β-Endorphin YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE μ-opioid receptor'†', δ-opioid receptor [8][9][10][7]
γ-Endorphin YGGFMTSEKSQTPLVTL μ-opioid receptor, unknown affinity for other opioid receptors [8]
Dynorphins
Dynorphin A YGGFLRRIRPKLKWDNQ κ-opioid receptor'†' [8][9][11]
Dynorphin A1–8 YGGFLRRI κ-opioid receptor, μ-opioid receptor (partial agonist at δ-opioid receptor) [12][13]
Dynorphin B YGGFLRRQFKVVT κ-opioid receptor [8][9]
Big dynorphin YGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVT κ-opioid receptor'†' [11][14][15]
Leumorphin YGGFLRRQFKVVTRSQEDPNAYYEELFDV κ-opioid receptor [16][17][18][19]
α-Neoendorphin YGGFLRKYPK κ-opioid receptor [8][9]
β-Neoendorphin YGGFLRKYP κ-opioid receptor [8]
Nociceptin
Nociceptin FGGFTGARKSARKLANQ nociceptin receptor'†' [8][9][20]
Endomorphins
Endomorphin-1 YPWF-NH2 μ-opioid receptor [8][9]
Endomorphin-2 YPFF-NH2 μ-opioid receptor [8][9]
This symbol next to a receptor indicates that the corresponding peptide is a principal endogenous agonist of the receptor in humans.
This symbol next to a receptor indicates that the corresponding peptide is the endogenous ligand with the highest known potency for the receptor in humans.

Opioid food peptides

Exogenous opioid substances are called exorphins, as opposed to endorphines. Exorphins include opioid food peptides like Gluten exorphin and opioid food peptides and are mostly contained in cereals and animal milk. They mimic the actions of endorphines because they bind to the same opioid receptors in the brain.

These are the most common exorphins:

Amphibian opioid peptides

Synthetic opioid peptides

Human Body Version 2.0

February 16, 2003 by Ray Kurzweil
Original link:  http://www.kurzweilai.net/human-body-version-20

In the coming decades, a radical upgrading of our body’s physical and mental systems, already underway, will use nanobots to augment and ultimately replace our organs. We already know how to prevent most degenerative disease through nutrition and supplementation; this will be a bridge to the emerging biotechnology revolution, which in turn will be a bridge to the nanotechnology revolution. By 2030, reverse-engineering of the human brain will have been completed and nonbiological intelligence will merge with our biological brains.

Sex has already been largely separated from its biological function. For the most part, we engage in sexual activity for intimate communication and sensual pleasure, not reproduction. Conversely, we have multiple methodologies for creating babies without physical sex, albeit most reproduction still does derive from the sex act. Although not condoned by all sectors of society, this disentanglement of sex from its biological function has been readily, even eagerly, adopted by the mainstream.

So why don’t we provide the same extrication of purpose from biology for another activity that also provides both social intimacy and sensual pleasure, namely eating? We have crude ways of doing this today. Starch blockers, such as Bayer’s Precose, partially prevent absorption of complex carbohydrates; fat blockers, such as Chitosan, bind to fat molecules, causing them to pass through the digestive tract; and sugar substitutes, such as Sucralose and Stevia, provide sweetness without calories. There are limitations and problems with each of these contemporary technologies, but a more effective generation of drugs is being developed that will block excess caloric absorption on the cellular level.

Let us consider, however, a more fundamental reengineering of the digestive process to disconnect the sensual aspects of eating from its original biological purpose: to provide nutrients into the bloodstream that are then delivered to each of our trillions of cells. These nutrients include caloric (energy-bearing) substances such as glucose (from carbohydrates), proteins, fats, and a myriad of trace molecules, such as vitamins, minerals, and phytochemicals, that provide building blocks and facilitating enzymes for diverse metabolic processes.

An Era of Abundance

Our knowledge of the complex pathways underlying digestive processes is rapidly expanding, although there is still a great deal we do not fully understand. On the one hand, digestion, like any other major human biological system, is astonishing in its intricacy and cleverness. Our bodies manage to extract the complex resources needed to survive, despite sharply varying conditions, while at the same time, filtering out a multiplicity of toxins.

On the other hand, our bodies evolved in a very different era. Our digestive processes in particular are optimized for a situation that is dramatically dissimilar to the one we find ourselves in. For most of our biological heritage, there was a high likelihood that the next foraging or hunting season (and for a brief, relatively recent period, the next planting season) might be catastrophically lean. So it made sense for our bodies to hold on to every possible calorie. Today, this biological strategy is extremely counterproductive. Our outdated metabolic programming underlies our contemporary epidemic of obesity and fuels pathological processes of degenerative disease such as coronary artery disease, and type II diabetes.

Up until recently (on an evolutionary time scale), it was not in the interest of the species for old people like myself (I was born in 1948) to use up the limited resources of the clan. Evolution favored a short life span—life expectancy was 37 years only two centuries ago—so these restricted reserves could be devoted to the young, those caring for them, and those strong enough to perform intense physical work.

We now live in an era of great material abundance. Most work requires mental effort rather than physical exertion. A century ago, 30 percent of the U.S. work force worked on farms, with another 30 percent deployed in factories. Both of these figures are now under 3 percent. The significant majority of today’s job categories, ranging from airline flight attendant to web designer, simply didn’t exist a century ago. Circa 2003, we have the opportunity to continue to contribute to our civilization’s exponentially growing knowledge base—incidentally, a unique attribute of our species—well past our child-rearing days.

Our species has already augmented the “natural” order of our life cycle through our technology: drugs, supplements, replacement parts for virtually all bodily systems, and many other interventions. We already have devices to replace our hips, knees, shoulders, elbows, wrists, jaws, teeth, skin, arteries, veins, heart valves, arms, legs, feet, fingers, and toes. Systems to replace more complex organs (for example, our hearts) are beginning to work. As we’re learning the principles of operation of the human body and the brain, we will soon be in a position to design vastly superior systems that will be more enjoyable, last longer, and perform better, without susceptibility to breakdown, disease, and aging.

Artist and cultural catalyst Natasha Vita-More pioneered a conceptual design for one such system, called Primo Posthuman, designed for mobility, flexibility and superlongevity. It features innovations such as a metabrain for global-net connection with prosthetic neo-neocortex of AI interwoven with nanobots; smart skin that is solar protected with biosensors for tone and texture changeability, and high-acuity senses.


Introducing Human Body Version 2.0

We won’t engineer human body version 2.0 all at once. It will be an incremental process, one already well under way. Although version 2.0 is a grand project, ultimately resulting in the radical upgrading of all our physical and mental systems, we will implement it one benign step at a time. Based on our current knowledge, we can already touch and feel the means for accomplishing each aspect of this vision.

From this perspective, let’s return to a consideration of the digestive system. We already have a reasonably comprehensive picture of the constituent ingredients of the food we eat. We already have the means to survive without eating, using intravenous nutrition (for people who are unable to eat), although this is clearly not a pleasant process, given the current limitations in our technologies for getting substances in and out of the blood stream.

The next phase of improvement will be largely biochemical, in the form of drugs and supplements that will block excess caloric absorption and otherwise reprogram metabolic pathways for optimal health. We already have the knowledge to prevent most instances of degenerative disease, such as heart disease, stroke, type II diabetes, and cancer, through comprehensive programs of nutrition and supplementation, something which I personally do, and will describe in an upcoming book (A Short Guide to a Long Life, coauthored with Terry Grossman, M.D.). I view our current knowledge as a bridge to the full flowering of the biotechnology revolution, which in turn will be a bridge to the nanotechnology revolution.

It’s All About Nanobots

In a famous scene from the movie, The Graduate, Benjamin’s mentor gives him career advice in a single word: “plastics.” Today, that word might be “software,” or “biotechnology,” but in another couple of decades, the word is likely to be “nanobots.” Nanobots—blood-cell-sized robots—will provide the means to radically redesign our digestive systems, and, incidentally, just about everything else.

In an intermediate phase, nanobots in the digestive tract and bloodstream will intelligently extract the precise nutrients we need, call for needed additional nutrients and supplements through our personal wireless local area network, and send the rest of the food we eat on its way to be passed through for elimination.

If this seems futuristic, keep in mind that intelligent machines are already making their way into our blood stream. There are dozens of projects underway to create blood-stream-based “biological microelectromechanical systems” (bioMEMS) with a wide range of diagnostic and therapeutic applications. BioMEMS devices are being designed to intelligently scout out pathogens and deliver medications in very precise ways.

For example, a researcher at the University of Illinois at Chicago has created a tiny capsule with pores measuring only seven nanometers. The pores let insulin out in a controlled manner but prevent antibodies from invading the pancreatic Islet cells inside the capsule. These nanoengineered devices have cured rats with type I diabetes, and there is no reason that the same methodology would fail to work in humans. Similar systems could precisely deliver dopamine to the brain for Parkinson’s patients, provide blood-clotting factors for patients with hemophilia, and deliver cancer drugs directly to tumor sites. A new design provides up to 20 substance-containing reservoirs that can release their cargo at programmed times and locations in the body.

Kensall Wise, a professor of electrical engineering at the University of Michigan, has developed a tiny neural probe that can provide precise monitoring of the electrical activity of patients with neural diseases. Future designs are expected to also deliver drugs to precise locations in the brain. Kazushi Ishiyama at Tohoku University in Japan has developed micromachines that use microscopic-sized spinning screws to deliver drugs to small cancer tumors.

A particularly innovative micromachine developed by Sandia National Labs has actual microteeth with a jaw that opens and closes to trap individual cells and then implant them with substances such as DNA, proteins or drugs. There are already at least four major scientific conferences on bioMEMS and other approaches to developing micro- and nano-scale machines to go into the body and bloodstream.

Ultimately, the individualized nutrients needed for each person will be fully understood (including all the hundreds of phytochemicals) and easily and inexpensively available, so we won’t need to bother with extracting nutrients from food at all. Just as we routinely engage in sex today for its relational and sensual gratification, we will gain the opportunity to disconnect the eating of food from the function of delivering nutrients into the bloodstream.

This technology should be reasonably mature by the 2020s. Nutrients will be introduced directly into the bloodstream by special metabolic nanobots. Sensors in our bloodstream and body, using wireless communication, will provide dynamic information on the nutrients needed at each point in time.

A key question in designing this technology will be the means by which these nanobots make their way in and out of the body. As I mentioned above, the technologies we have today, such as intravenous catheters, leave much to be desired. A significant benefit of nanobot technology is that unlike mere drugs and nutritional supplements, nanobots have a measure of intelligence. They can keep track of their own inventories, and intelligently slip in and out of our bodies in clever ways. One scenario is that we would wear a special “nutrient garment” such as a belt or undershirt. This garment would be loaded with nutrient bearing nanobots, which would make their way in and out of our bodies through the skin or other body cavities.

At this stage of technological development, we will be able to eat whatever we want, whatever gives us pleasure and gastronomic fulfillment, and thereby unreservedly explore the culinary arts for their tastes, textures, and aromas. At the same time, we will provide an optimal flow of nutrients to our bloodstream, using a completely separate process. One possibility would be that all the food we eat would pass through a digestive tract that is now disconnected from any possible absorption into the bloodstream.

This would place a burden on our colon and bowel functions, so a more refined approach will dispense with the function of elimination. We will be able to accomplish this using special elimination nanobots that act like tiny garbage compactors. As the nutrient nanobots make their way from the nutrient garment into our bodies, the elimination nanobots will go the other way. Periodically, we would replace the nutrition garment for a fresh one. One might comment that we do obtain some pleasure from the elimination function, but I suspect that most people would be happy to do without it.

Ultimately we won’t need to bother with special garments or explicit nutritional resources. Just as computation will eventually be ubiquitous and available everywhere, so too will basic metabolic nanobot resources be embedded everywhere in our environment. In addition, an important aspect of this system will be maintaining ample reserves of all needed resources inside the body. Our version 1.0 bodies do this to only a very limited extent, for example, storing a few minutes of oxygen in our blood, and a few days of caloric energy in glycogen and other reserves. Version 2.0 will provide substantially greater reserves, enabling us to be separated from metabolic resources for greatly extended periods of time.

Once perfected, we will no longer need version 1.0 of our digestive system at all. I pointed out above that our adoption of these technologies will be cautious and incremental, so we will not dispense with the old-fashioned digestive process when these technologies are first introduced. Most of us will wait for digestive system version 2.1 or even 2.2 before being willing to do dispense with version 1.0. After all, people didn’t throw away their typewriters when the first generation of word processors was introduced. People held onto their vinyl record collections for many years after CDs came out (I still have mine). People are still holding onto their film cameras, although the tide is rapidly turning in favor of digital cameras.

However, these new technologies do ultimately dominate, and few people today still own a typewriter. The same phenomenon will happen with our reengineered bodies. Once we’ve worked out the inevitable complications that will arise with a radically reengineered gastrointestinal system, we will begin to rely on it more and more.

Programmable Blood

As we reverse-engineer (learn the principles of operation of) our various bodily systems, we will be in a position to engineer new systems that provide dramatic improvements. One pervasive system that has already been the subject of a comprehensive conceptual redesign is our blood.

One of the leading proponents of “nanomedicine,” (redesigning our biological systems through engineering on a molecular scale) and author of a book with the same name is Robert Freitas, Research Scientist at nanotechnology firm Zyvex Corp. Freitas’ ambitious manuscript is a comprehensive road map to rearchitecting our biological heritage. One of Freitas’ designs is to replace (or augment) our red blood cells with artificial “respirocytes” that would enable us to hold our breath for four hours or do a top-speed sprint for 15 minutes without taking a breath. Like most of our biological systems, our red blood cells perform their oxygenating function very inefficiently, and Freitas has redesigned them for optimal performance. He has worked out many of the physical and chemical requirements in impressive detail.

It will be interesting to see how this development is dealt with in athletic contests. Presumably, the use of respirocytes and similar systems will be prohibited from Olympic contests, but then we will have the specter of teenagers in junior high school gymnasiums routinely outperforming Olympic athletes.

Freitas envisions micron-size artificial platelets that could achieve hemostasis (bleeding control) up to 1,000 times faster than biological platelets. Freitas describes nanorobotic microbivores (white blood cell replacements) that will download software to destroy specific infections hundreds of times faster than antibiotics, and that will be effective against all bacterial, viral and fungal infections, with no limitations of drug resistance.

I’ve personally watched (through a microscope) my own white blood cells surround and devour a pathogen, and I was struck with the remarkable sluggishness of this natural process. Although replacing our blood with billions of nanorobotic devices will require a lengthy process of development, refinement, and regulatory approval, we already have the conceptual knowledge to engineer substantial improvements over the remarkable but very inefficient methods used in our biological bodies.

Have a Heart, or Not

The next organ on my hit list is the heart. It’s a remarkable machine, but it has a number of severe problems. It is subject to a myriad of failure modes, and represents a fundamental weakness in our potential longevity. The heart usually breaks down long before the rest of the body, and often very prematurely.

Although artificial hearts are beginning to work, a more effective approach will be to get rid of the heart altogether. Among Freitas’ designs are nanorobotic blood cell replacements that provide their own mobility. If the blood system moves with its own movement, the engineering issues of the extreme pressures required for centralized pumping can be eliminated. As we perfect the means of transferring nanobots to and from the blood supply, we can also continuously replace the nanobots comprising our blood supply.

Energy will be provided by microscopic-sized hydrogen fuel cells. Integrated Fuel Cell Technologies, one of many companies pioneering fuel cell technology, has already created microscopic-sized fuel cells. Their first-generation design provides tens of thousands of fuel cells on an integrated circuit and is intended to power portable electronics.

With the respirocytes providing greatly extended access to oxygenation, we will be in a position to eliminate the lungs by using nanobots to provide oxygen and remove carbon dioxide. One might point out that we take pleasure in breathing (even more so than elimination!). As with all of these redesigns, we will certainly go through intermediate stages where these technologies augment our natural systems, so we can have the best of both worlds. Eventually, however, there will be no reason to continue with the complications of actual breathing and the requirement of having breathable air everywhere we go. If we really find breathing that pleasurable, we will develop virtual ways of having this sensual experience.

We also won’t need the various organs that produce chemicals, hormones, and enzymes that flow into the blood and other metabolic pathways. We already create bio-identical versions of many of these substances, and we will have the means to routinely create all biochemically relevant substances within a couple of decades. These substances (to the extent that we still need them) will be delivered via nanobots, controlled by intelligent biofeedback systems to maintain and balance required levels, just as our “natural” systems do today (for example, the control of insulin levels by the pancreatic Islet cells). Since we are eliminating most of our biological organs, many of these substances may no longer be needed, and will be replaced by other resources that are required by the nanorobotic systems.

Similarly the organs that filter the blood for impurities, such as the kidneys, can also be replaced by nanorobot-based elimination services.

It is important to emphasize that this redesign process will not be accomplished in a single design cycle. Each organ and each idea will have its own progression, intermediate designs, and stages of implementation. Nonetheless, we are clearly headed towards a fundamental and radical redesign of the extremely inefficient and limited functionality of human body version 1.0.

So What’s Left?

Let’s consider where we are. We’ve eliminated the heart, lungs, red and white blood cells, platelets, pancreas, thyroid and all the hormone-producing organs, kidneys, bladder, liver, lower esophagus, stomach, small intestines, large intestines, and bowel. What we have left at this point is the skeleton, skin, sex organs, mouth and upper esophagus, and brain.

The skeleton is a stable structure, and we already have a reasonable understanding of how it works. We replace parts of it today, although our current technology for doing this has severe limitations. Interlinking nanobots will provide the ability to augment and ultimately replace the skeleton. Replacing portions of the skeleton today requires painful surgery, but replacing it through nanobots from within can be a gradual and noninvasive process. The human skeleton version 2.0 will very strong, stable, and self repairing.

We will not notice the absence of many of our organs, such as the liver and pancreas, as we do not directly experience their functionality. The skin, however, is an organ we will actually want to keep, or at least we will want to maintain its functionality. The skin, which includes our primary and secondary sex organs, provides a vital function of communication and pleasure. Nonetheless, we will ultimately be able to improve on the skin with new nanoengineered supple materials that will provide greater protection from physical and thermal environmental effects while enhancing our capacity for intimate communication and pleasure. The same observation holds for the mouth and upper esophagus, which comprise the remaining aspects of the digestive system that we use to experience the act of eating.

Redesigning the Human Brain

The process of reverse engineering and redesign will also encompass the most important system in our bodies: the brain. The brain is at least as complex as all the other organs put together, with approximately half of our genetic code devoted to its design. It is a misconception to regard the brain as a single organ. It is actually an intricate collection of information-processing organs, interconnected in an elaborate hierarchy, as is the accident of our evolutionary history.

The process of understanding the principles of operation of the human brain is already well under way. The underlying technologies of brain scanning and neuron modeling are scaling up exponentially, as is our overall knowledge of human brain function. We already have detailed mathematical models of a couple dozen of the several hundred regions that comprise the human brain.

The age of neural implants is also well under way. We have brain implants based on “neuromorphic” modeling (i.e., reverse-engineering of the human brain and nervous system) for a rapidly growing list of brain regions. A friend of mine who became deaf while an adult can now engage in telephone conversations again because of his cochlear implant, a device that interfaces directly with the auditory nervous system. He plans to replace it with a new model with a thousand levels of frequency discrimination, which will enable him to hear music once again. He laments that he has had the same melodies playing in his head for the past 15 years and is looking forward to hearing some new tunes. A future generation of cochlear implants now on the drawing board will provide levels of frequency discrimination that go significantly beyond that of “normal” hearing.

Researchers at MIT and Harvard are developing neural implants to replace damaged retinas. There are brain implants for Parkinson’s patients that communicate directly with the ventral posterior nucleus and subthalmic nucleus regions of the brain to reverse the most devastating symptoms of this disease. An implant for people with cerebral palsy and multiple sclerosis communicates with the ventral lateral thalamus and has been effective in controlling tremors. “Rather than treat the brain like soup, adding chemicals that enhance or suppress certain neurotransmitters,” says Rick Trosch, an American physician helping to pioneer these therapies, “we’re now treating it like circuitry.”

A variety of techniques are being developed to provide the communications bridge between the wet analog world of biological information processing and digital electronics. Researchers at Germany’s Max Planck Institute have developed noninvasive devices that can communicate with neurons in both directions. They demonstrated their “neuron transistor” by controlling the movements of a living leech from a personal computer. Similar technology has been used to reconnect leech neurons and to coax them to perform simple logical and arithmetic problems. Scientists are now experimenting with a new design called “quantum dots,” which uses tiny crystals of semiconductor material to connect electronic devices with neurons.

These developments provide the promise of reconnecting broken neural pathways for people with nerve damage and spinal cord injuries. It has long been thought that recreating these pathways would only be feasible for recently injured patients because nerves gradually deteriorate when unused. A recent discovery, however, shows the feasibility of a neuroprosthetic system for patients with long-standing spinal cord injuries. Researchers at the University of Utah asked a group of long-term quadriplegic patients to move their limbs in a variety of ways and then observed the response of their brains, using magnetic resonance imaging (MRI). Although the neural pathways to their limbs had been inactive for many years, the pattern of their brain activity when attempting to move their limbs was very close to that observed in non-disabled persons.

We will, therefore, be able to place sensors in the brain of a paralyzed person (e.g., Christopher Reeve) that will be programmed to recognize the brain patterns associated with intended movements and then stimulate the appropriate sequence of muscle movements. For those patients whose muscles no longer function, there are already designs for “nanoelectromechanical” systems (NEMS) that can expand and contract to replace damaged muscles and that can be activated by either real or artificial nerves.

We Are Becoming Cyborgs

We are rapidly growing more intimate with our technology. Computers started out as large remote machines in air-conditioned rooms tended by white-coated technicians. Subsequently they moved onto our desks, then under our arms, and now in our pockets. Soon, we’ll routinely put them inside our bodies and brains. Ultimately we will become more nonbiological than biological.

The compelling benefits in overcoming profound diseases and disabilities will keep these technologies on a rapid course, but medical applications represent only the early adoption phase. As the technologies become established, there will be no barriers to using them for the expansion of human potential. In my view, expanding our potential is precisely the primary distinction of our species.

Moreover, all of the underlying technologies are accelerating. The power of computation has grown at a double exponential rate for all of the past century, and will continue to do so well into this century through the power of three-dimensional computing. Communication bandwidths and the pace of brain reverse-engineering are also quickening. Meanwhile, according to my models, the size of technology is shrinking at a rate of 5.6 per linear dimension per decade, which will make nanotechnology ubiquitous during the 2020s.

By the end of this decade, computing will disappear as a separate technology that we need to carry with us. We’ll routinely have high-resolution images encompassing the entire visual field written directly to our retinas from our eyeglasses and contact lenses (the Department of Defense is already using technology along these lines from Microvision, a company based in Bothell, Washington). We’ll have very-high-speed wireless connection to the Internet at all times. The electronics for all of this will be embedded in our clothing. Circa 2010, these very personal computers will enable us to meet with each other in full-immersion, visual-auditory, virtual-reality environments as well as augment our vision with location- and time-specific information at all times.

By 2030, electronics will utilize molecule-sized circuits, the reverse-engineering of the human brain will have been completed, and bioMEMS will have evolved into bioNEMS (biological nanoelectromechanical systems). It will be routine to have billions of nanobots (nano-scale robots) coursing through the capillaries of our brains, communicating with each other (over a wireless local area network), as well as with our biological neurons and with the Internet. One application will be to provide full-immersion virtual reality that encompasses all of our senses. When we want to enter a virtual-reality environment, the nanobots will replace the signals from our real senses with the signals that our brain would receive if we were actually in the virtual environment.

We will have a panoply of virtual environments to choose from, including earthly worlds that we are familiar with, as well as those with no earthly counterpart. We will be able to go to these virtual places and have any kind of interaction with other real (as well as simulated) people, ranging from business negotiations to sensual encounters. In virtual reality, we won’t be restricted to a single personality, since we will be able to change our appearance and become other people.

Experience Beamers

“Experience beamers” will beam their entire flow of sensory experiences as well as the neurological correlates of their emotional reactions out on the Web just as people today beam their bedroom images from their web cams. A popular pastime will be to plug in to someone else’s sensory-emotional beam and experience what it’s like to be someone else, à la the plot concept of the movie “Being John Malkovich.” There will also be a vast selection of archived experiences to choose from. The design of virtual environments and the creation of archived full-immersion experiences will become new art forms.

The most important application of circa-2030 nanobots will be to literally expand our minds. We’re limited today to a mere hundred trillion interneuronal connections; we will be able to augment these by adding virtual connections via nanobot communication. This will provide us with the opportunity to vastly expand our pattern recognition abilities, memories, and overall thinking capacity as well as directly interface with powerful forms of nonbiological intelligence.

It’s important to note that once nonbiological intelligence gets a foothold in our brains (a threshold we’ve already passed), it will grow exponentially, as is the accelerating nature of information-based technologies. A one-inch cube of nanotube circuitry (which is already working at smaller scales in laboratories) will be at least a million times more powerful than the human brain. By 2040, the nonbiological portion of our intelligence will be far more powerful than the biological portion. It will, however, still be part of the human-machine civilization, having been derived from human intelligence, i.e., created by humans (or machines created by humans) and based at least in part on the reverse-engineering of the human nervous system.

Stephen Hawking recently commented in the German magazine Focus that computer intelligence will surpass that of humans within a few decades. He advocated that we “develop as quickly as possible technologies that make possible a direct connection between brain and computer, so that artificial brains contribute to human intelligence rather than opposing it.” Hawking can take comfort that the development

program he is recommending is well under way.

© 2003 Ray Kurzweil.

Acupuncture

From Wikipedia, the free encyclopedia
 
Acupuncture
Acupuncture1-1.jpg
Needles being inserted into a person's arm
Alternative therapy
Benefits Placebo
MeSH D015670
ICD-10-PCS 8E0H30Z
ICD-9 99.91-99.92
OPS-301 code 8-975.2

Acupuncture
Traditional Chinese 針灸[1]
Simplified Chinese 针灸
Literal meaning "needling [and] moxibustion"

Acupuncture is a form of alternative medicine[3] in which thin needles are inserted into the body.[4] It is a key component of traditional Chinese medicine (TCM). TCM theory and practice are not based upon scientific knowledge,[5] and acupuncture is a pseudoscience.[6][7] There is a diverse range of acupuncture theories based on different philosophies,[8] and techniques vary depending on the country.[9] The method used in TCM is likely the most widespread in the United States.[3] It is most often used for pain relief,[10][11] though it is also used for a wide range of other conditions. Acupuncture is generally used only in combination with other forms of treatment.

The conclusions of many trials and numerous systematic reviews of acupuncture are largely inconsistent, which suggests that it is not effective.[10][13] An overview of Cochrane reviews found that acupuncture is not effective for a wide range of conditions.[13] A systematic review found little evidence of acupuncture's effectiveness in treating pain.[10] The evidence suggests that short-term treatment with acupuncture does not produce long-term benefits.[14] Some research results suggest acupuncture can alleviate pain, though the majority of research suggests that acupuncture's effects are mainly due to the placebo effect.[9] A systematic review concluded that the analgesic effect of acupuncture seemed to lack clinical relevance and could not be clearly distinguished from bias.[15] A meta-analysis found that acupuncture for chronic low back pain was cost-effective as an adjunct to standard care,[16] while a systematic review found insufficient evidence for the cost-effectiveness of acupuncture in the treatment of chronic low back pain.[17]

Acupuncture is generally safe when done by an appropriately trained practitioner using clean needle technique and single-use needles.[18][19] When properly delivered, it has a low rate of mostly minor adverse effects.[4][18] Accidents and infections are associated with infractions of sterile technique or neglect of the practitioner.[19] A review stated that the reports of infection transmission increased significantly in the prior decade.[20] The most frequently reported adverse events were pneumothorax and infections.[10] Since serious adverse events continue to be reported, it is recommended that acupuncturists be trained sufficiently to reduce the risk.[10]

Scientific investigation has not found any histological or physiological evidence for traditional Chinese concepts such as qi, meridians, and acupuncture points,[n 1][24] and many modern practitioners no longer support the existence of life force energy (qi) flowing through meridians, which was a major part of early belief systems.[8][25][26] Acupuncture is believed to have originated around 100 BC in China, around the time The Yellow Emperor's Classic of Internal Medicine (Huangdi Neijing) was published,[27] though some experts suggest it could have been practiced earlier.[9] Over time, conflicting claims and belief systems emerged about the effect of lunar, celestial and earthly cycles, yin and yang energies, and a body's "rhythm" on the effectiveness of treatment.[28] Acupuncture grew and diminished in popularity in China repeatedly, depending on the country's political leadership and the favor of rationalism or Western medicine.[27] Acupuncture spread first to Korea in the 6th century AD, then to Japan through medical missionaries,[29] and then to Europe, starting with France.[27] In the 20th century, as it spread to the United States and Western countries, the spiritual elements of acupuncture that conflict with Western beliefs were sometimes abandoned in favor of simply tapping needles into acupuncture points.[27][30][31]

Clinical practice

One type of acupuncture needle

Acupuncture is a form of alternative medicine.[3] It is used most commonly for pain relief,[10][11] though it is also used to treat a wide range of conditions. The majority of people who seek out acupuncture do so for musculoskeletal problems, including low back pain, shoulder stiffness, and knee pain.[32] Acupuncture is generally only used in combination with other forms of treatment.[12] For example, American Society of Anesthesiologists states it may be considered in the treatment for nonspecific, noninflammatory low back pain only in conjunction with conventional therapy.[33]

Acupuncture is the insertion of thin needles into the skin.[4] According to the Mayo Foundation for Medical Education and Research (Mayo Clinic), a typical session entails lying still while approximately five to twenty needles are inserted; for the majority of cases, the needles will be left in place for ten to twenty minutes.[34] It can be associated with the application of heat, pressure, or laser light.[4] Classically, acupuncture is individualized and based on philosophy and intuition, and not on scientific research.[35] There is also a non-invasive therapy developed in early 20th century Japan using an elaborate set of "needles" for the treatment of children (shōnishin or shōnihari).[36][37]

Clinical practice varies depending on the country.[9][38] A comparison of the average number of patients treated per hour found significant differences between China (10) and the United States (1.2).[39] Chinese herbs are often used.[40] There is a diverse range of acupuncture approaches, involving different philosophies.[8] Although various different techniques of acupuncture practice have emerged, the method used in traditional Chinese medicine (TCM) seems to be the most widely adopted in the US.[3] Traditional acupuncture involves needle insertion, moxibustion, and cupping therapy,[18] and may be accompanied by other procedures such as feeling the pulse and other parts of the body and examining the tongue.[3] Traditional acupuncture involves the belief that a "life force" (qi) circulates within the body in lines called meridians.[41] The main methods practiced in the UK are TCM and Western medical acupuncture.[42] The term Western medical acupuncture is used to indicate an adaptation of TCM-based acupuncture which focuses less on TCM.[41][43] The Western medical acupuncture approach involves using acupuncture after a medical diagnosis.[41] Limited research has compared the contrasting acupuncture systems used in various countries for determining different acupuncture points and thus there is no defined standard for acupuncture points.[44]

In traditional acupuncture, the acupuncturist decides which points to treat by observing and questioning the patient to make a diagnosis according to the tradition used. In TCM, the four diagnostic methods are: inspection, auscultation and olfaction, inquiring, and palpation. Inspection focuses on the face and particularly on the tongue, including analysis of the tongue size, shape, tension, color and coating, and the absence or presence of teeth marks around the edge.[45] Auscultation and olfaction involve listening for particular sounds such as wheezing, and observing body odor.[45] Inquiring involves focusing on the "seven inquiries": chills and fever; perspiration; appetite, thirst and taste; defecation and urination; pain; sleep; and menses and leukorrhea.[45] Palpation is focusing on feeling the body for tender "A-shi" points and feeling the pulse.[45]

Needles

Acupuncture needles
 
Traditional and modern Japanese guiding tube needles

The most common mechanism of stimulation of acupuncture points employs penetration of the skin by thin metal needles, which are manipulated manually or the needle may be further stimulated by electrical stimulation (electroacupuncture).[3] Acupuncture needles are typically made of stainless steel, making them flexible and preventing them from rusting or breaking.[46] Needles are usually disposed of after each use to prevent contamination.[46] Reusable needles when used should be sterilized between applications.[46][47] Needles vary in length between 13 to 130 millimetres (0.51 to 5.12 in), with shorter needles used near the face and eyes, and longer needles in areas with thicker tissues; needle diameters vary from 0.16 mm (0.006 in) to 0.46 mm (0.018 in),[48] with thicker needles used on more robust patients. Thinner needles may be flexible and require tubes for insertion. The tip of the needle should not be made too sharp to prevent breakage, although blunt needles cause more pain.[49]

Apart from the usual filiform needle, other needle types include three-edged needles and the Nine Ancient Needles.[48] Japanese acupuncturists use extremely thin needles that are used superficially, sometimes without penetrating the skin, and surrounded by a guide tube (a 17th-century invention adopted in China and the West). Korean acupuncture uses copper needles and has a greater focus on the hand.[38]

Needling technique

Insertion

The skin is sterilized and needles are inserted, frequently with a plastic guide tube. Needles may be manipulated in various ways, including spinning, flicking, or moving up and down relative to the skin. Since most pain is felt in the superficial layers of the skin, a quick insertion of the needle is recommended.[50] Often the needles are stimulated by hand in order to cause a dull, localized, aching sensation that is called de qi, as well as "needle grasp," a tugging feeling felt by the acupuncturist and generated by a mechanical interaction between the needle and skin.[3] Acupuncture can be painful.[51] The skill level of the acupuncturist may influence how painful the needle insertion is, and a sufficiently skilled practitioner may be able to insert the needles without causing any pain.[50]

De-qi sensation

De-qi (Chinese: 得气; pinyin: dé qì; "arrival of qi") refers to a sensation of numbness, distension, or electrical tingling at the needling site which might radiate along the corresponding meridian. If de-qi can not be generated, then inaccurate location of the acupoint, improper depth of needle insertion, inadequate manual manipulation, or a very weak constitution of the patient can be considered, all of which are thought to decrease the likelihood of successful treatment. If the de-qi sensation does not immediately occur upon needle insertion, various manual manipulation techniques can be applied to promote it (such as "plucking", "shaking" or "trembling").[52]

Once de-qi is achieved, further techniques might be utilized which aim to "influence" the de-qi; for example, by certain manipulation the de-qi sensation allegedly can be conducted from the needling site towards more distant sites of the body. Other techniques aim at "tonifying" (Chinese: ; pinyin: ) or "sedating" (Chinese: ; pinyin: xiè) qi.[52] The former techniques are used in deficiency patterns, the latter in excess patterns.[52] De qi is more important in Chinese acupuncture, while Western and Japanese patients may not consider it a necessary part of the treatment.[38]

Related practices

  • Acupressure, a non-invasive form of bodywork, uses physical pressure applied to acupressure points by the hand or elbow, or with various devices.[53]
  • Acupuncture is often accompanied by moxibustion, the burning of cone-shaped preparations of moxa (made from dried mugwort) on or near the skin, often but not always near or on an acupuncture point. Traditionally, acupuncture was used to treat acute conditions while moxibustion was used for chronic diseases. Moxibustion could be direct (the cone was placed directly on the skin and allowed to burn the skin, producing a blister and eventually a scar), or indirect (either a cone of moxa was placed on a slice of garlic, ginger or other vegetable, or a cylinder of moxa was held above the skin, close enough to either warm or burn it).[54]
  • Cupping therapy is an ancient Chinese form of alternative medicine in which a local suction is created on the skin; practitioners believe this mobilizes blood flow in order to promote healing.[55]
  • Tui na is a TCM method of attempting to stimulate the flow of qi by various bare-handed techniques that do not involve needles.[56]
  • Electroacupuncture is a form of acupuncture in which acupuncture needles are attached to a device that generates continuous electric pulses (this has been described as "essentially transdermal electrical nerve stimulation [TENS] masquerading as acupuncture").[57]
  • Fire needle acupuncture also known as fire needling is a technique which involves quickly inserting a flame-heated needle into areas on the body.[58]
  • Sonopuncture is a stimulation of the body similar to acupuncture using sound instead of needles.[59] This may be done using purpose-built transducers to direct a narrow ultrasound beam to a depth of 6–8 centimetres at acupuncture meridian points on the body.[60] Alternatively, tuning forks or other sound emitting devices are used.[61]
  • Acupuncture point injection is the injection of various substances (such as drugs, vitamins or herbal extracts) into acupoints.[62] This technique combines traditional acupuncture with injection of what is often an effective dose of an approved pharmaceutical drug, and proponents claim that it may be more effective than either treatment alone, especially for the treatment of some kinds of chronic pain. However, a 2016 review found that most published trials of the technique were of poor value due to methodology issues and larger trials would be needed to draw useful conclusions.[63]
  • Auriculotherapy, commonly known as ear acupuncture, auricular acupuncture, or auriculoacupuncture, is considered to date back to ancient China. It involves inserting needles to stimulate points on the outer ear.[64] The modern approach was developed in France during the early 1950s.[64] There is no scientific evidence that it can cure disease; the evidence of effectiveness is negligible.[64]
  • Scalp acupuncture, developed in Japan, is based on reflexological considerations regarding the scalp.
  • Hand acupuncture, developed in Korea, centers around assumed reflex zones of the hand. Medical acupuncture attempts to integrate reflexological concepts, the trigger point model, and anatomical insights (such as dermatome distribution) into acupuncture practice, and emphasizes a more formulaic approach to acupuncture point location.[65]
  • Cosmetic acupuncture is the use of acupuncture in an attempt to reduce wrinkles on the face.[66]
  • Bee venom acupuncture is a treatment approach of injecting purified, diluted bee venom into acupoints.[67]
  • A 2006 review of veterinary acupuncture found that there is insufficient evidence to "recommend or reject acupuncture for any condition in domestic animals".[68] Rigorous evidence for complementary and alternative techniques is lacking in veterinary medicine but evidence has been growing.[69]

Effectiveness

Acupuncture has been researched extensively; as of 2013, there were almost 1,500 randomized controlled trials on PubMed with "acupuncture" in the title. The results of reviews of reviews of acupuncture's effectiveness, however, have been inconclusive.[70]

Sham acupuncture and research

It is difficult but not impossible to design rigorous research trials for acupuncture.[71][72] Due to acupuncture's invasive nature, one of the major challenges in efficacy research is in the design of an appropriate placebo control group.[73][74] For efficacy studies to determine whether acupuncture has specific effects, "sham" forms of acupuncture where the patient, practitioner, and analyst are blinded seem the most acceptable approach.[71] Sham acupuncture uses non-penetrating needles or needling at non-acupuncture points,[75] e.g. inserting needles on meridians not related to the specific condition being studied, or in places not associated with meridians.[76] The under-performance of acupuncture in such trials may indicate that therapeutic effects are due entirely to non-specific effects, or that the sham treatments are not inert, or that systematic protocols yield less than optimal treatment.[77][78]

A 2014 review in Nature Reviews Cancer found that "contrary to the claimed mechanism of redirecting the flow of qi through meridians, researchers usually find that it generally does not matter where the needles are inserted, how often (that is, no dose-response effect is observed), or even if needles are actually inserted. In other words, 'sham' or 'placebo' acupuncture generally produces the same effects as 'real' acupuncture and, in some cases, does better."[79] A 2013 meta-analysis found little evidence that the effectiveness of acupuncture on pain (compared to sham) was modified by the location of the needles, the number of needles used, the experience or technique of the practitioner, or by the circumstances of the sessions.[80] The same analysis also suggested that the number of needles and sessions is important, as greater numbers improved the outcomes of acupuncture compared to non-acupuncture controls.[80] There has been little systematic investigation of which components of an acupuncture session may be important for any therapeutic effect, including needle placement and depth, type and intensity of stimulation, and number of needles used.[77] The research seems to suggest that needles do not need to stimulate the traditionally specified acupuncture points or penetrate the skin to attain an anticipated effect (e.g. psychosocial factors).[3]

A response to "sham" acupuncture in osteoarthritis may be used in the elderly, but placebos have usually been regarded as deception and thus unethical.[81] However, some physicians and ethicists have suggested circumstances for applicable uses for placebos such as it might present a theoretical advantage of an inexpensive treatment without adverse reactions or interactions with drugs or other medications.[81] As the evidence for most types of alternative medicine such as acupuncture is far from strong, the use of alternative medicine in regular healthcare can present an ethical question.[82]

Using the principles of evidence-based medicine to research acupuncture is controversial, and has produced different results.[73] Some research suggests acupuncture can alleviate pain but the majority of research suggests that acupuncture's effects are mainly due to placebo.[9] Evidence suggests that any benefits of acupuncture are short-lasting.[14] There is insufficient evidence to support use of acupuncture compared to mainstream medical treatments.[83] Acupuncture is not better than mainstream treatment in the long term.[76]

Publication bias

Publication bias is cited as a concern in the reviews of randomized controlled trials (RCTs) of acupuncture.[57][84][85] A 1998 review of studies on acupuncture found that trials originating in China, Japan, Hong Kong, and Taiwan were uniformly favourable to acupuncture, as were ten out of eleven studies conducted in Russia.[86] A 2011 assessment of the quality of RCTs on TCM, including acupuncture, concluded that the methodological quality of most such trials (including randomization, experimental control, and blinding) was generally poor, particularly for trials published in Chinese journals (though the quality of acupuncture trials was better than the trials testing TCM remedies).[87] The study also found that trials published in non-Chinese journals tended to be of higher quality.[87] Chinese authors use more Chinese studies, which have been demonstrated to be uniformly positive.[88] A 2012 review of 88 systematic reviews of acupuncture published in Chinese journals found that less than half of these reviews reported testing for publication bias, and that the majority of these reviews were published in journals with impact factors of zero.[89] A 2015 study comparing pre-registered records of acupuncture trials with their published results found that it was uncommon for such trials to be registered before the trial began. This study also found that selective reporting of results and changing outcome measures to obtain statistically significant results was common in this literature.[90]

Scientist and journalist Steven Salzberg identifies acupuncture and Chinese medicine generally as a focus for "fake medical journals" such as the Journal of Acupuncture and Meridian Studies and Acupuncture in Medicine.[91]

Specific conditions

Pain

The conclusions of many trials and numerous systematic reviews of acupuncture are largely inconsistent with each other.[13] A 2011 systematic review of systematic reviews found that for reducing pain, real acupuncture was no better than sham acupuncture, and concluded that numerous reviews have shown little convincing evidence that acupuncture is an effective treatment for reducing pain.[10] The same review found that neck pain was one of only four types of pain for which a positive effect was suggested, but cautioned that the primary studies used carried a considerable risk of bias.[10] A 2009 overview of Cochrane reviews found acupuncture is not effective for a wide range of conditions.[13]

A 2014 systematic review suggests that the nocebo effect of acupuncture is clinically relevant and that the rate of adverse events may be a gauge of the nocebo effect.[92] According to the 2014 Miller's Anesthesia book, "when compared with placebo, acupuncture treatment has proven efficacy for relieving pain".[44] A 2012 meta-analysis conducted by the Acupuncture Trialists' Collaboration found "relatively modest" efficiency of acupuncture (in comparison to sham) for the treatment of four different types of chronic pain (back and neck pain, knee osteoarthritis, chronic headache, and shoulder pain) and on that basis concluded that it "is more than a placebo" and a reasonable referral option.[93] Commenting on this meta-analysis, both Edzard Ernst and David Colquhoun said the results were of negligible clinical significance.[94][95] Edzard Ernst later stated that "I fear that, once we manage to eliminate this bias [that operators are not blind] … we might find that the effects of acupuncture exclusively are a placebo response."[96] In 2017, the same research group updated their previous meta-analysis and again found acupuncture to be superior to sham acupuncture for non-specific musculoskeletal pain, osteoarthritis, chronic headache, and shoulder pain. They also found that the effects of acupuncture decreased by about 15% after one year.[97]

A 2010 systematic review suggested that acupuncture is more than a placebo for commonly occurring chronic pain conditions, but the authors acknowledged that it is still unknown if the overall benefit is clinically meaningful or cost-effective.[98] A 2010 review found real acupuncture and sham acupuncture produce similar improvements, which can only be accepted as evidence against the efficacy of acupuncture.[99] The same review found limited evidence that real acupuncture and sham acupuncture appear to produce biological differences despite similar effects.[99] A 2009 systematic review and meta-analysis found that acupuncture had a small analgesic effect, which appeared to lack any clinical importance and could not be discerned from bias.[15] The same review found that it remains unclear whether acupuncture reduces pain independent of a psychological impact of the needling ritual.[15] A 2017 systematic review and meta-analysis found that ear acupuncture may be effective at reducing pain within 48 hours of its use, but the mean difference between the acupuncture and control groups was small and that "Rigorous research is needed to establish definitive evidence".[100]

Lower back pain

A 2013 systematic review found that acupuncture may be effective for nonspecific lower back pain, but the authors noted there were limitations in the studies examined, such as heterogeneity in study characteristics and low methodological quality in many studies.[101] A 2012 systematic review found some supporting evidence that acupuncture was more effective than no treatment for chronic non-specific low back pain; the evidence was conflicting comparing the effectiveness over other treatment approaches.[12] A 2011 systematic review of systematic reviews found that "for chronic low back pain, individualized acupuncture is not better in reducing symptoms than formula acupuncture or sham acupuncture with a toothpick that does not penetrate the skin."[10] A 2010 review found that sham acupuncture was as effective as real acupuncture for chronic low back pain.[3] The specific therapeutic effects of acupuncture were small, whereas its clinically relevant benefits were mostly due to contextual and psychosocial circumstances.[3] Brain imaging studies have shown that traditional acupuncture and sham acupuncture differ in their effect on limbic structures, while at the same time showed equivalent analgesic effects.[3] A 2005 Cochrane review found insufficient evidence to recommend for or against either acupuncture or dry needling for acute low back pain.[102] The same review found low quality evidence for pain relief and improvement compared to no treatment or sham therapy for chronic low back pain only in the short term immediately after treatment.[102] The same review also found that acupuncture is not more effective than conventional therapy and other alternative medicine treatments.[102] A 2017 systematic review and meta-analysis concluded that, for neck pain, acupuncture was comparable in effectiveness to conventional treatment, while electroacupuncture was even more effective in reducing pain than was conventional acupuncture. The same review noted that "It is difficult to draw conclusion [sic] because the included studies have a high risk of bias and imprecision."[103] A 2015 overview of systematic reviews of variable quality showed that acupuncture can provide short-term improvements to people with chronic Low Back Pain.[104] The overview said this was true when acupuncture was used either in isolation or in addition to conventional therapy.[104] A 2017 systematic review for an American College of Physicians clinical practice guideline found low to moderate evidence that acupuncture was effective for chronic low back pain, and limited evidence that it was effective for acute low back pain. The same review found that the strength of the evidence for both conditions was low to moderate.[105] Another 2017 clinical practice guideline, this one produced by the Danish Health Authority, recommended against acupuncture for both recent-onset low back pain and lumbar radiculopathy.[106]

Headaches and migraines

Two separate 2016 Cochrane reviews found that acupuncture could be useful in the prophylaxis of tension-type headaches and episodic migraines.[107][108] The 2016 Cochrane review evaluating acupuncture for episodic migraine prevention concluded that true acupuncture had a small effect beyond sham acupuncture and found moderate-quality evidence to suggest that acupuncture is at least similarly effective to prophylactic medications for this purpose.[108] A 2012 review found that acupuncture has demonstrated benefit for the treatment of headaches, but that safety needed to be more fully documented in order to make any strong recommendations in support of its use.[109]

Arthritis pain

A 2014 review concluded that "current evidence supports the use of acupuncture as an alternative to traditional analgesics in osteoarthritis patients."[110] As of 2014, a meta-analysis showed that acupuncture may help osteoarthritis pain but it was noted that the effects were insignificant in comparison to sham needles.[111] A 2013 systematic review and network meta-analysis found that the evidence suggests that acupuncture may be considered one of the more effective physical treatments for alleviating pain due to knee osteoarthritis in the short-term compared to other relevant physical treatments, though much of the evidence in the topic is of poor quality and there is uncertainty about the efficacy of many of the treatments.[112] A 2012 review found "the potential beneficial action of acupuncture on osteoarthritis pain does not appear to be clinically relevant."[76] A 2010 Cochrane review found that acupuncture shows statistically significant benefit over sham acupuncture in the treatment of peripheral joint osteoarthritis; however, these benefits were found to be so small that their clinical significance was doubtful, and "probably due at least partially to placebo effects from incomplete blinding".[113]

A 2013 Cochrane review found low to moderate evidence that acupuncture improves pain and stiffness in treating people with fibromyalgia compared with no treatment and standard care.[114] A 2012 review found "there is insufficient evidence to recommend acupuncture for the treatment of fibromyalgia."[76] A 2010 systematic review found a small pain relief effect that was not apparently discernible from bias; acupuncture is not a recommendable treatment for the management of fibromyalgia on the basis of this review.[115]

A 2012 review found that the effectiveness of acupuncture to treat rheumatoid arthritis is "sparse and inconclusive."[76] A 2005 Cochrane review concluded that acupuncture use to treat rheumatoid arthritis "has no effect on ESR, CRP, pain, patient's global assessment, number of swollen joints, number of tender joints, general health, disease activity and reduction of analgesics."[116] A 2010 overview of systematic reviews found insufficient evidence to recommend acupuncture in the treatment of most rheumatic conditions, with the exceptions of osteoarthritis, low back pain, and lateral elbow pain.[117]

Other joint pain

A 2014 systematic review found that although manual acupuncture was effective at relieving short-term pain when used to treat tennis elbow, its long-term effect in relieving pain was "unremarkable".[118] A 2007 review found that acupuncture was significantly better than sham acupuncture at treating chronic knee pain; the evidence was not conclusive due to the lack of large, high-quality trials.[119] A 2005 Cochrane Review concluded that there is not enough evidence to determine if acupuncture is effective as a method to treat shoulder pain.[120]

Post-operative pain and nausea

A 2014 overview of systematic reviews found insufficient evidence to suggest that acupuncture is an effective treatment for postoperative nausea and vomiting (PONV) in a clinical setting.[121] A 2013 systematic review concluded that acupuncture might be beneficial in prevention and treatment of PONV.[122] A 2009 Cochrane review found that stimulation of the P6 acupoint on the wrist was as effective (or ineffective) as antiemetic drugs and was associated with minimal side effects.[121][123] The same review found "no reliable evidence for differences in risks of postoperative nausea or vomiting after P6 acupoint stimulation compared to antiemetic drugs."[123]

A 2014 overview of systematic reviews found insufficient evidence to suggest that acupuncture is effective for surgical or post-operative pain.[121] For the use of acupuncture for post-operative pain, there was contradictory evidence.[121] A 2014 systematic review found supportive but limited evidence for use of acupuncture for acute post-operative pain after back surgery.[124] A 2014 systematic review found that while the evidence suggested acupuncture could be an effective treatment for postoperative gastroparesis, a firm conclusion could not be reached because the trials examined were of low quality.[125]

Pain and nausea associated with cancer and cancer treatment

A 2015 Cochrane review found that there is insufficient evidence to determine whether acupuncture is an effective treatment for cancer pain in adults.[126] A 2014 systematic review published in the Chinese Journal of Integrative Medicine found that acupuncture may be effective as an adjunctive treatment to palliative care for cancer patients.[127] A 2013 overview of reviews published in the Journal of Multinational Association for Supportive Care in Cancer found evidence that acupuncture could be beneficial for people with cancer-related symptoms, but also identified few rigorous trials and high heterogeneity between trials.[128] A 2012 systematic review of randomised clinical trials published in the same journal found that the number and quality of RCTs for using acupuncture in the treatment of cancer pain was too low to draw definite conclusions.[129]

A 2014 systematic review reached inconclusive results with regard to the effectiveness of acupuncture for treating cancer-related fatigue.[130] A 2013 systematic review found that acupuncture is an acceptable adjunctive treatment for chemotherapy-induced nausea and vomiting, but that further research with a low risk of bias is needed.[131] A 2013 systematic review found that the quantity and quality of available RCTs for analysis were too low to draw valid conclusions for the effectiveness of acupuncture for cancer-related fatigue.[132]

Sleep

A 2016 systematic review and meta-analysis found that acupuncture was "associated with a significant reduction in sleep disturbances in women experiencing menopause-related sleep disturbances."[133]

Other conditions

For the following conditions, the Cochrane Collaboration or other reviews have concluded there is no strong evidence of benefit: alcohol dependence,[134] allergy,[135][136][137] Alzheimer's disease,[138] angina pectoris,[139] ankle sprain,[140][141] asthma,[142][143] attention deficit hyperactivity disorder,[144][145] autism,[146][147] baby colic,[148] Bell's palsy,[149][150] cardiac arrhythmias,[151] carpal tunnel syndrome,[152] cerebral hemorrhage,[153] chronic obstructive pulmonary disease,[154] cocaine dependence,[155] constipation,[156] depression,[157][158] diabetic peripheral neuropathy,[159] dysphagia after acute stroke,[160] drug detoxification,[161][162] dry eye,[163] primary dysmenorrhoea,[164] dyspepsia,[165] endometriosis,[166] enuresis,[167] epilepsy,[168] erectile dysfunction,[169] glaucoma,[170] gynaecological conditions (except possibly fertility and nausea/vomiting),[171] acute hordeolum,[172] hot flashes,[173][174][175] essential hypertension,[176] hypoxic ischemic encephalopathy in newborn babies, in vitro fertilization (IVF),[177] induction of childbirth,[178] insomnia,[179][180][181] irritable bowel syndrome,[182] labor induction,[183] labor pain,[184][185] lumbar spinal stenosis,[186] major depressive disorders in pregnant women,[187] mumps (children),[188] musculoskeletal disorders of the extremities,[189] myopia,[190] neuropathic pain,[191] obesity,[192][193] obstetrical conditions,[194] opioid addiction,[195][196] Parkinson's disease,[197] polycystic ovary syndrome,[198][199] posttraumatic stress disorder,[200] premenstrual syndrome,[201] preoperative anxiety,[202] restless legs syndrome,[203] schizophrenia,[204] sensorineural hearing loss,[205] smoking cessation,[206] stress urinary incontinence,[207] stroke,[208] acute stroke,[209] stroke rehabilitation,[210] temporomandibular joint dysfunction,[211][212] tennis elbow,[213] tinnitus,[214][215] traumatic brain injury,[216] uremic itching,[217] uterine fibroids,[218] vascular dementia[219] whiplash,[220] and xerostomia.[221]

Moxibustion and cupping

A 2010 overview of systematic reviews found that moxibustion was effective for several conditions but the primary studies were of poor quality, so there persists ample uncertainty, which limits the conclusiveness of their findings.[222]

Safety

Adverse events

Acupuncture is generally safe when administered by an experienced, appropriately trained practitioner using clean-needle technique and sterile single-use needles.[18][19] When improperly delivered it can cause adverse effects.[18] Accidents and infections are associated with infractions of sterile technique or neglect on the part of the practitioner.[19] To reduce the risk of serious adverse events after acupuncture, acupuncturists should be trained sufficiently.[10] People with serious spinal disease, such as cancer or infection, are not good candidates for acupuncture.[3] Contraindications to acupuncture (conditions that should not be treated with acupuncture) include coagulopathy disorders (e.g. hemophilia and advanced liver disease), warfarin use, severe psychiatric disorders (e.g. psychosis), and skin infections or skin trauma (e.g. burns).[3] Further, electroacupuncture should be avoided at the spot of implanted electrical devices (such as pacemakers).[3]

A 2011 systematic review of systematic reviews (internationally and without language restrictions) found that serious complications following acupuncture continue to be reported.[10] Between 2000 and 2009, ninety-five cases of serious adverse events, including five deaths, were reported.[10] Many such events are not inherent to acupuncture but are due to malpractice of acupuncturists.[10] This might be why such complications have not been reported in surveys of adequately-trained acupuncturists.[10] Most such reports originate from Asia, which may reflect the large number of treatments performed there or a relatively higher number of poorly trained Asian acupuncturists.[10] Many serious adverse events were reported from developed countries.[10] These included Australia, Austria, Canada, Croatia, France, Germany, Ireland, the Netherlands, New Zealand, Spain, Sweden, Switzerland, the UK, and the US.[10] The number of adverse effects reported from the UK appears particularly unusual, which may indicate less under-reporting in the UK than other countries.[10] Reports included 38 cases of infections and 42 cases of organ trauma.[10] The most frequent adverse events included pneumothorax, and bacterial and viral infections.[10]

A 2013 review found (without restrictions regarding publication date, study type or language) 295 cases of infections; mycobacterium was the pathogen in at least 96%.[20] Likely sources of infection include towels, hot packs or boiling tank water, and reusing reprocessed needles.[20] Possible sources of infection include contaminated needles, reusing personal needles, a person's skin containing mycobacterium, and reusing needles at various sites in the same person.[20] Although acupuncture is generally considered a safe procedure, a 2013 review stated that the reports of infection transmission increased significantly in the prior decade, including those of mycobacterium.[20] Although it is recommended that practitioners of acupuncture use disposable needles, the reuse of sterilized needles is still permitted.[20] It is also recommended that thorough control practices for preventing infection be implemented and adapted.[20]

English-language

A 2013 systematic review of the English-language case reports found that serious adverse events associated with acupuncture are rare, but that acupuncture is not without risk.[18] Between 2000 and 2011 the English-language literature from 25 countries and regions reported 294 adverse events.[18] The majority of the reported adverse events were relatively minor, and the incidences were low.[18] For example, a prospective survey of 34,000 acupuncture treatments found no serious adverse events and 43 minor ones, a rate of 1.3 per 1000 interventions.[18] Another survey found there were 7.1% minor adverse events, of which 5 were serious, amid 97,733 acupuncture patients.[18] The most common adverse effect observed was infection (e.g. mycobacterium), and the majority of infections were bacterial in nature, caused by skin contact at the needling site.[18] Infection has also resulted from skin contact with unsterilized equipment or with dirty towels in an unhygienic clinical setting.[18] Other adverse complications included five reported cases of spinal cord injuries (e.g. migrating broken needles or needling too deeply), four brain injuries, four peripheral nerve injuries, five heart injuries, seven other organ and tissue injuries, bilateral hand edema, epithelioid granuloma, pseudolymphoma, argyria, pustules, pancytopenia, and scarring due to hot-needle technique.[18] Adverse reactions from acupuncture, which are unusual and uncommon in typical acupuncture practice, included syncope, galactorrhoea, bilateral nystagmus, pyoderma gangrenosum, hepatotoxicity, eruptive lichen planus, and spontaneous needle migration.[18]

A 2013 systematic review found 31 cases of vascular injuries caused by acupuncture, three resulting in death.[223] Two died from pericardial tamponade and one was from an aortoduodenal fistula.[223] The same review found vascular injuries were rare, bleeding and pseudoaneurysm were most prevalent.[223] A 2011 systematic review (without restriction in time or language), aiming to summarize all reported case of cardiac tamponade after acupuncture, found 26 cases resulting in 14 deaths, with little doubt about causality in most fatal instances.[224] The same review concluded cardiac tamponade was a serious, usually fatal, though theoretically avoidable complication following acupuncture, and urged training to minimize risk.[224]

A 2012 review found a number of adverse events were reported after acupuncture in the UK's National Health Service (NHS) but most (95%) were not severe,[42] though miscategorization and under-reporting may alter the total figures.[42] From January 2009 to December 2011, 468 safety incidents were recognized within the NHS organizations.[42] The adverse events recorded included retained needles (31%), dizziness (30%), loss of consciousness/unresponsive (19%), falls (4%), bruising or soreness at needle site (2%), pneumothorax (1%) and other adverse side effects (12%).[42] Acupuncture practitioners should know, and be prepared to be responsible for, any substantial harm from treatments.[42] Some acupuncture proponents argue that the long history of acupuncture suggests it is safe.[42] However, there is an increasing literature on adverse events (e.g. spinal-cord injury).[42]

Acupuncture seems to be safe in people getting anticoagulants, assuming needles are used at the correct location and depth.[225] Studies are required to verify these findings.[225] The evidence suggests that acupuncture might be a safe option for people with allergic rhinitis.[135]

Chinese, South Korean, and Japanese-language

A 2010 systematic review of the Chinese-language literature found numerous acupuncture-related adverse events, including pneumothorax, fainting, subarachnoid hemorrhage, and infection as the most frequent, and cardiovascular injuries, subarachnoid hemorrhage, pneumothorax, and recurrent cerebral hemorrhage as the most serious, most of which were due to improper technique.[226] Between 1980 and 2009, the Chinese-language literature reported 479 adverse events.[226]  Prospective surveys show that mild, transient acupuncture-associated adverse events ranged from 6.71% to 15%.[226] In a study with 190,924 patients, the prevalence of serious adverse events was roughly 0.024%.[226] Another study showed a rate of adverse events requiring specific treatment of 2.2%, 4,963 incidences among 229,230 patients.[226] Infections, mainly hepatitis, after acupuncture are reported often in English-language research, though are rarely reported in Chinese-language research, making it plausible that acupuncture-associated infections have been underreported in China.[226] Infections were mostly caused by poor sterilization of acupuncture needles.[226] Other adverse events included spinal epidural hematoma (in the cervical, thoracic and lumbar spine), chylothorax, injuries of abdominal organs and tissues, injuries in the neck region, injuries to the eyes, including orbital hemorrhage, traumatic cataract, injury of the oculomotor nerve and retinal puncture, hemorrhage to the cheeks and the hypoglottis, peripheral motor-nerve injuries and subsequent motor dysfunction, local allergic reactions to metal needles, stroke, and cerebral hemorrhage after acupuncture.[226]

A causal link between acupuncture and the adverse events cardiac arrest, pyknolepsy, shock, fever, cough, thirst, aphonia, leg numbness, and sexual dysfunction remains uncertain.[226] The same review concluded that acupuncture can be considered inherently safe when practiced by properly trained practitioners, but the review also stated there is a need to find effective strategies to minimize the health risks.[226] Between 1999 and 2010, the Republic of Korean-literature contained reports of 1104 adverse events.[227] Between the 1980s and 2002, the Japanese-language literature contained reports of 150 adverse events.[228]

Children and pregnancy

Although acupuncture has been practiced for thousands of years in China, its use in pediatrics in the United States did not become common until the early 2000s. In 2007, the National Health Interview Survey (NHIS) conducted by the National Center For Health Statistics (NCHS) estimated that approximately 150,000 children had received acupuncture treatment for a variety of conditions.[229]

In 2008 a study determined that the use of acupuncture-needle treatment on children was "questionable" due to the possibility of adverse side-effects and the pain manifestation differences in children versus adults. The study also includes warnings against practicing acupuncture on infants, as well as on children who are over-fatigued, very weak, or have over-eaten.[230]

When used on children, acupuncture is considered safe when administered by well-trained, licensed practitioners using sterile needles; however, a 2011 review found there was limited research to draw definite conclusions about the overall safety of pediatric acupuncture.[4] The same review found 279 adverse events, 25 of them serious.[4] The adverse events were mostly mild in nature (e.g. bruising or bleeding).[4] The prevalence of mild adverse events ranged from 10.1% to 13.5%, an estimated 168 incidences among 1,422 patients.[4] On rare occasions adverse events were serious (e.g. cardiac rupture or hemoptysis); many might have been a result of substandard practice.[4] The incidence of serious adverse events was 5 per one million, which included children and adults.[4]

When used during pregnancy, the majority of adverse events caused by acupuncture were mild and transient, with few serious adverse events.[231] The most frequent mild adverse event was needling or unspecified pain, followed by bleeding.[231] Although two deaths (one stillbirth and one neonatal death) were reported, there was a lack of acupuncture-associated maternal mortality.[231] Limiting the evidence as certain, probable or possible in the causality evaluation, the estimated incidence of adverse events following acupuncture in pregnant women was 131 per 10,000.[231] Although acupuncture is not contraindicated in pregnant women, some specific acupuncture points are particularly sensitive to needle insertion; these spots, as well as the abdominal region, should be avoided during pregnancy.[3]

Moxibustion and cupping

Four adverse events associated with moxibustion were bruising, burns and cellulitis, spinal epidural abscess, and large superficial basal cell carcinoma.[18] Ten adverse events were associated with cupping.[18] The minor ones were keloid scarring, burns, and bullae;[18] the serious ones were acquired hemophilia A, stroke following cupping on the back and neck, factitious panniculitis, reversible cardiac hypertrophy, and iron deficiency anemia.[18]

Cost-effectiveness

A 2013 meta-analysis found that acupuncture for chronic low back pain was cost-effective as a complement to standard care, but not as a substitute for standard care except in cases where comorbid depression presented.[16] The same meta-analysis found there was no difference between sham and non-sham acupuncture.[16] A 2011 systematic review found insufficient evidence for the cost-effectiveness of acupuncture in the treatment of chronic low back pain.[17] A 2010 systematic review found that the cost-effectiveness of acupuncture could not be concluded.[98] A 2012 review found that acupuncture seems to be cost-effective for some pain conditions.[232]

Risk of forgoing conventional medical care

As with other alternative medicines, unethical or naïve practitioners may induce patients to exhaust financial resources by pursuing ineffective treatment.[5][233] Professional ethics codes set by accrediting organizations such as the National Certification Commission for Acupuncture and Oriental Medicine require practitioners to make "timely referrals to other health care professionals as may be appropriate."[234] Stephen Barrett states that there is a "risk that an acupuncturist whose approach to diagnosis is not based on scientific concepts will fail to diagnose a dangerous condition".[235]

Conceptual basis

Acupuncture
Simplified Chinese 针刺

Traditional

Old Chinese medical chart of acupuncture meridians

Acupuncture is a substantial part of traditional Chinese medicine (TCM). Early acupuncture beliefs relied on concepts that are common in TCM, such as a life force energy called qi.[236] Qi was believed to flow from the body's primary organs (zang-fu organs) to the "superficial" body tissues of the skin, muscles, tendons, bones, and joints, through channels called meridians.[237] Acupuncture points where needles are inserted are mainly (but not always) found at locations along the meridians.[238] Acupuncture points not found along a meridian are called extraordinary points and those with no designated site are called "A-shi" points.[238]

In TCM, disease is generally perceived as a disharmony or imbalance in energies such as yin, yang, qi, xuĕ, zàng-fǔ, meridians, and of the interaction between the body and the environment.[239] Therapy is based on which "pattern of disharmony" can be identified.[240][241] For example, some diseases are believed to be caused by meridians being invaded with an excess of wind, cold, and damp.[242] In order to determine which pattern is at hand, practitioners examine things like the color and shape of the tongue, the relative strength of pulse-points, the smell of the breath, the quality of breathing, or the sound of the voice.[243][244] TCM and its concept of disease does not strongly differentiate between the cause and effect of symptoms.[245]

Purported scientific basis

Modern acupuncture model

Scientific research has not supported the existence of qi, meridians, or yin and yang.[n 1][24][25] A Nature editorial described TCM as "fraught with pseudoscience", with the majority of its treatments having no logical mechanism of action.[246] Quackwatch states that "TCM theory and practice are not based upon the body of knowledge related to health, disease, and health care that has been widely accepted by the scientific community. TCM practitioners disagree among themselves about how to diagnose patients and which treatments should go with which diagnoses. Even if they could agree, the TCM theories are so nebulous that no amount of scientific study will enable TCM to offer rational care."[5]

Some modern practitioners support the use of acupuncture to treat pain, but have abandoned the use of qi, meridians, yin, yang and other energies based in mysticism as explanatory frameworks.[8][25][26] The use of qi as an explanatory framework has been decreasing in China, even as it becomes more prominent during discussions of acupuncture in the US.[247] Academic discussions of acupuncture still make reference to pseudoscientific concepts such as qi and meridians despite the lack of scientific evidence.[247] Many within the scientific community consider attempts to rationalize acupuncture in science to be quackery, pseudoscience and "theatrical placebo".[248] Academics Massimo Pigliucci and Maarten Boudry describe it as a "borderlands science" lying between science and pseudoscience.[249]

Many acupuncturists attribute pain relief to the release of endorphins when needles penetrate, but no longer support the idea that acupuncture can affect a disease.[26][247] It is a generally held belief within the acupuncture community that acupuncture points and meridians structures are special conduits for electrical signals, but no research has established any consistent anatomical structure or function for either acupuncture points or meridians.[n 1][24] Human tests to determine whether electrical continuity was significantly different near meridians than other places in the body have been inconclusive.[24]

Some studies suggest acupuncture causes a series of events within the central nervous system,[250] and that it is possible to inhibit acupuncture's analgesic effects with the opioid antagonist naloxone.[251] Mechanical deformation of the skin by acupuncture needles appears to result in the release of adenosine.[3] The anti-nociceptive effect of acupuncture may be mediated by the adenosine A1 receptor.[252] A 2014 review in Nature Reviews Cancer found that since the key mouse studies that suggested acupuncture relieves pain via the local release of adenosine, which then triggered nearby A1 receptors "caused more tissue damage and inflammation relative to the size of the animal in mice than in humans, such studies unnecessarily muddled a finding that local inflammation can result in the local release of adenosine with analgesic effect."[79]

It has been proposed that acupuncture's effects in gastrointestinal disorders may relate to its effects on the parasympathetic and sympathetic nervous system, which have been said to be the "Western medicine" equivalent of "yin and yang".[253] Another mechanism whereby acupuncture may be effective for gastrointestinal dysfunction involves the promotion of gastric peristalsis in subjects with low initial gastric motility, and suppressing peristalsis in subjects with active initial motility.[254] Acupuncture has also been found to exert anti-inflammatory effects, which may be mediated by the activation of the vagus nerve and deactivation of inflammatory macrophages.[255] Neuroimaging studies suggest that acupuncture stimulation results in deactivation of the limbic brain areas and the default mode network.[256]

History

Origins

Acupuncture chart from the Ming dynasty (c. 1368–1644)

Acupuncture, along with moxibustion, is one of the oldest practices of traditional Chinese medicine.[29] Most historians believe the practice began in China, though there are some conflicting narratives on when it originated.[27][30] Academics David Ramey and Paul Buell said the exact date acupuncture was founded depends on the extent dating of ancient texts can be trusted and the interpretation of what constitutes acupuncture.[257]

According to an article in Rheumatology, the first documentation of an "organized system of diagnosis and treatment" for acupuncture was in The Yellow Emperor's Classic of Internal Medicine (Huangdi Neijing) from about 100 BC.[27] Gold and silver needles found in the tomb of Liu Sheng from around 100 BC are believed to be the earliest archeological evidence of acupuncture, though it is unclear if that was their purpose.[257] According to Plinio Prioreschi, the earliest known historical record of acupuncture is the Shih-Chi ("Record of History"), written by a historian around 100 BC.[28] It is believed that this text was documenting what was established practice at that time.[27]

Alternate theories

The 5,000-year-old mummified body of Ötzi the Iceman was found with 15 groups of tattoos,[258] many of which were located at points on the body where acupuncture needles are used for abdominal or lower back problems. Evidence from the body suggests Otzi suffered from these conditions.[30] This has been cited as evidence that practices similar to acupuncture may have been practiced elsewhere in Eurasia during the early Bronze Age;[258] however, The Oxford Handbook of the History of Medicine calls this theory "speculative".[31] It is considered unlikely that acupuncture was practiced before 2000 BC.[257] The Ötzi the Iceman's tattoo marks suggest to some experts that an acupuncture-like treatment was previously used in Europe 5 millennia ago.[9]

Acupuncture may have been practiced during the Neolithic era, near the end of the stone age, using sharpened stones called Bian shi.[29]:70 Many Chinese texts from later eras refer to sharp stones called "plen", which means "stone probe", that may have been used for acupuncture purposes.[29]:70 The ancient Chinese medical text, Huangdi Neijing, indicates that sharp stones were believed at-the-time to cure illnesses at or near the body's surface, perhaps because of the short depth a stone could penetrate.[29]:71 However, it is more likely that stones were used for other medical purposes, such as puncturing a growth to drain its pus.[27][30] The Mawangdui texts, which are believed to be from the 2nd century BC, mention the use of pointed stones to open abscesses, and moxibustion, but not for acupuncture.[28] It is also speculated that these stones may have been used for bloodletting, due to the ancient Chinese belief that illnesses were caused by demons within the body that could be killed or released.[259] It is likely bloodletting was an antecedent to acupuncture.[30]

According to historians Lu Gwei-djen and Joseph Needham, there is substantial evidence that acupuncture may have begun around 600 BC.[29] Some hieroglyphs and pictographs from that era suggests acupuncture and moxibustion were practiced.[260] However, historians Gwei-djen and Needham said it was unlikely a needle could be made out of the materials available in China during this time period.[29]:71-72 It is possible Bronze was used for early acupuncture needles. Tin, copper, gold and silver are also possibilities, though they are considered less likely, or to have been used in fewer cases.[29]:69 If acupuncture was practiced during the Shang dynasty (1766 to 1122 BC), organic materials like thorns, sharpened bones, or bamboo may have been used.[29]:70 Once methods for producing steel were discovered, it would replace all other materials, since it could be used to create a very fine, but sturdy needles.[29]:74 Gwei-djen and Needham noted that all the ancient materials that could have been used for acupuncture and which often produce archeological evidence, such as sharpened bones, bamboo or stones, were also used for other purposes.[29] An article in Rheumatology said that the absence of any mention of acupuncture in documents found in the tomb of Ma-Wang-Dui from 198 BC suggest that acupuncture was not practiced by that time.[27]

Belief systems

Several different and sometimes conflicting belief systems emerged regarding acupuncture. This may have been the result of competing schools of thought.[27] Some ancient texts referred to using acupuncture to cause bleeding, while others mixed the ideas of blood-letting and spiritual ch'i energy. Over time, the focus shifted from blood to the concept of puncturing specific points on the body, and eventually to balancing Yin and Yang energies as well.[28] According to David Ramey, no single "method or theory" was ever predominantly adopted as the standard.[261] At the time, scientific knowledge of medicine was not yet developed, especially because in China dissection of the deceased was forbidden, preventing the development of basic anatomical knowledge.[27]

It is not certain when specific acupuncture points were introduced, but the autobiography of Pien Chhio from around 400–500 BC references inserting needles at designated areas.[29] Bian Que believed there was a single acupuncture point at the top of one's skull that he called the point "of the hundred meetings."[29]:83 Texts dated to be from 156–186 BC document early beliefs in channels of life force energy called meridians that would later be an element in early acupuncture beliefs.[257]

Ramey and Buell said the "practice and theoretical underpinnings" of modern acupuncture were introduced in The Yellow Emperor's Classic (Huangdi Neijing) around 100 BC.[28][257] It introduced the concept of using acupuncture to manipulate the flow of life energy (qi) in a network of meridian (channels) in the body.[257][262] The network concept was made up of acu-tracts, such as a line down the arms, where it said acupoints were located. Some of the sites acupuncturists use needles at today still have the same names as those given to them by the Yellow Emperor's Classic.[29]:93 Numerous additional documents were published over the centuries introducing new acupoints.[29]:101 By the 4th century AD, most of the acupuncture sites in use today had been named and identified.[29]:101

Early development in China

Establishment and growth

In the first half of the 1st century AD, acupuncturists began promoting the belief that acupuncture's effectiveness was influenced by the time of day or night, the lunar cycle, and the season. The Science of the Yin-Yang Cycles (Yün Chhi Hsüeh) was a set of beliefs that curing diseases relied on the alignment of both heavenly (thien) and earthly (ti) forces that were attuned to cycles like that of the sun and moon.[29]:140-141 There were several different belief systems that relied on a number of celestial and earthly bodies or elements that rotated and only became aligned at certain times. According to Needham and Gwei-djen, these "arbitrary predictions" were depicted by acupuncturists in complex charts and through a set of special terminology.[29]

Acupuncture needles during this period were much thicker than most modern ones and often resulted in infection. Infection is caused by a lack of sterilization, but at that time it was believed to be caused by use of the wrong needle, or needling in the wrong place, or at the wrong time.[29]:102-103 Later, many needles were heated in boiling water, or in a flame. Sometimes needles were used while they were still hot, creating a cauterizing effect at the injection site.[29]:104 Nine needles were recommended in the Chen Chiu Ta Chheng from 1601, which may have been because of an ancient Chinese belief that nine was a magic number.[29]:102-103

Other belief systems were based on the idea that the human body operated on a rhythm and acupuncture had to be applied at the right point in the rhythm to be effective.[29]:140-141 In some cases a lack of balance between Yin and Yang were believed to be the cause of disease.[29]:140-141

In the 1st century AD, many of the first books about acupuncture were published and recognized acupuncturist experts began to emerge. The Zhen Jiu Jia Yi Jing, which was published in the mid-3rd century, became the oldest acupuncture book that is still in existence in the modern era.[29] Other books like the Yu Kuei Chen Ching, written by the Director of Medical Services for China, were also influential during this period, but were not preserved.[29] In the mid 7th century, Sun Simiao published acupuncture-related diagrams and charts that established standardized methods for finding acupuncture sites on people of different sizes and categorized acupuncture sites in a set of modules.[29]

Acupuncture became more established in China as improvements in paper led to the publication of more acupuncture books. The Imperial Medical Service and the Imperial Medical College, which both supported acupuncture, became more established and created medical colleges in every province.[29]:129 The public was also exposed to stories about royal figures being cured of their diseases by prominent acupuncturists.[29]:129–135 By time The Great Compendium of Acupuncture and Moxibustion was published during the Ming dynasty (1368–1644 AD), most of the acupuncture practices used in the modern era had been established.[27]

Decline

By the end of the Song dynasty (1279 AD), acupuncture had lost much of its status in China.[263] It became rarer in the following centuries, and was associated with less prestigious professions like alchemy, shamanism, midwifery and moxibustion.[264] Additionally, by the 18th century, scientific rationality was becoming more popular than traditional superstitious beliefs.[27] By 1757 a book documenting the history of Chinese medicine called acupuncture a "lost art".[29]:160 Its decline was attributed in part to the popularity of prescriptions and medications, as well as its association with the lower classes.[265]

In 1822, the Chinese Emperor signed a decree excluding the practice of acupuncture from the Imperial Medical Institute.[27] He said it was unfit for practice by gentlemen-scholars.[266] In China acupuncture was increasingly associated with lower-class, illiterate practitioners.[267] It was restored for a time, but banned again in 1929 in favor of science-based Western medicine. Although acupuncture declined in China during this time period, it was also growing in popularity in other countries.[30]

International expansion

Acupuncture chart from Shisi jing fahui (Expression of the Fourteen Meridians) written by Hua Shou (fl. 1340s, Ming dynasty). Japanese reprint by Suharaya Heisuke (Edo, 1. year Kyōhō = 1716).

Korea is believed to be the first country in Asia that acupuncture spread to outside of China.[29] Within Korea there is a legend that acupuncture was developed by emperor Dangun, though it is more likely to have been brought into Korea from a Chinese colonial prefecture in 514 AD. Acupuncture use was commonplace in Korea by the 6th century. It spread to Vietnam in the 8th and 9th centuries.[30] As Vietnam began trading with Japan and China around the 9th century, it was influenced by their acupuncture practices as well.[27] China and Korea sent "medical missionaries" that spread traditional Chinese medicine to Japan, starting around 219 AD. In 553, several Korean and Chinese citizens were appointed to re-organize medical education in Japan and they incorporated acupuncture as part of that system.[29]:264 Japan later sent students back to China and established acupuncture as one of five divisions of the Chinese State Medical Administration System.[29]:264-265

Acupuncture began to spread to Europe in the second half of the 17th century. Around this time the surgeon-general of the Dutch East India Company met Japanese and Chinese acupuncture practitioners and later encouraged Europeans to further investigate it.[29]:264-265 He published the first in-depth description of acupuncture for the European audience and created the term "acupuncture" in his 1683 work De Acupunctura.[259] France was an early adopter among the West due to the influence of Jesuit missionaries, who brought the practice to French clinics in the 16th century.[27] The French doctor Louis Berlioz (the father of the composer Hector Berlioz) is usually credited with being the first to experiment with the procedure in Europe in 1810, before publishing his findings in 1816.[266]

By the 19th century, acupuncture had become commonplace in many areas of the world.[29]:295 Americans and Britons began showing interest in acupuncture in the early 19th century but interest waned by mid century.[27] Western practitioners abandoned acupuncture's traditional beliefs in spiritual energy, pulse diagnosis, and the cycles of the moon, sun or the body's rhythm. Diagrams of the flow of spiritual energy, for example, conflicted with the West's own anatomical diagrams. It adopted a new set of ideas for acupuncture based on tapping needles into nerves.[27][30][31] In Europe it was speculated that acupuncture may allow or prevent the flow of electricity in the body, as electrical pulses were found to make a frog's leg twitch after death.[259]

The West eventually created a belief system based on Travell trigger points that were believed to inhibit pain. They were in the same locations as China's spiritually identified acupuncture points, but under a different nomenclature.[27] The first elaborate Western treatise on acupuncture was published in 1683 by Willem ten Rhijne.[268]

Modern era

In China, the popularity of acupuncture rebounded in 1949 when Mao Zedong took power and sought to unite China behind traditional cultural values. It was also during this time that many Eastern medical practices were consolidated under the name traditional Chinese medicine (TCM).[30]

New practices were adopted in the 20th century, such as using a cluster of needles,[29]:164 electrified needles, or leaving needles inserted for up to a week.[29]:164 A lot of emphasis developed on using acupuncture on the ear.[29]:164 Acupuncture research organizations were founded in the 1950s and acupuncture services became available in modern hospitals.[27] China, where acupuncture was believed to have originated, was increasingly influenced by Western medicine.[27] Meanwhile, acupuncture grew in popularity in the US. The US Congress created the Office of Alternative Medicine in 1992 and the National Institutes of Health (NIH) declared support for acupuncture for some conditions in November 1997. In 1999, the National Center for Complementary and Alternative Medicine was created within the NIH. Acupuncture became the most popular alternative medicine in the US.[250]

Politicians from the Chinese Communist Party said acupuncture was superstitious and conflicted with the party's commitment to science.[269] Communist Party Chairman Mao Zedong later reversed this position,[269] arguing that the practice was based on scientific principles.[270]

In 1971, a New York Times reporter published an article on his acupuncture experiences in China, which led to more investigation of and support for acupuncture.[27] The US President Richard Nixon visited China in 1972.[271] During one part of the visit, the delegation was shown a patient undergoing major surgery while fully awake, ostensibly receiving acupuncture rather than anesthesia.[271] Later it was found that the patients selected for the surgery had both a high pain tolerance and received heavy indoctrination before the operation; these demonstration cases were also frequently receiving morphine surreptitiously through an intravenous drip that observers were told contained only fluids and nutrients.[271] One patient receiving open heart surgery while awake was ultimately found to have received a combination of three powerful sedatives as well as large injections of a local anesthetic into the wound.[57] After the National Institute of Health expressed support for acupuncture for a limited number of conditions, adoption in the US grew further.[27] In 1972 the first legal acupuncture center in the US was established in Washington DC[272] and in 1973 the American Internal Revenue Service allowed acupuncture to be deducted as a medical expense.[273]

In 2006, a BBC documentary Alternative Medicine filmed a patient undergoing open heart surgery allegedly under acupuncture-induced anesthesia. It was later revealed that the patient had been given a cocktail of anesthetics.[274][275]

In 2010, UNESCO inscribed "acupuncture and moxibustion of traditional Chinese medicine" on the UNESCO Intangible Cultural Heritage List following China's nomination.[276]

Adoption

Acupuncture is popular in China,[226] the US,[18] Australia,[277] and Europe[278] including all five Nordic countries, though less so in Finland.[279] It is most heavily practiced in China[226] and is one of the most common alternative medicine practices in Europe.[278]:45 In Switzerland, acupuncture has become the most frequently used alternative medicine since 2004.[280] In the United Kingdom, a total of 4 million acupuncture treatments were administered in 2009.[281] Acupuncture is used in most pain clinics and hospices in the UK.[41] An estimated 1 in 10 adults in Australia used acupuncture in 2004.[277] In Japan, it is estimated that 25 percent of the population will try acupuncture at some point,[32] though in most cases it is not covered by public health insurance.[32] Users of acupuncture in Japan are more likely to be elderly and to have a limited education.[32] Approximately half of users surveyed indicated a likelihood to seek such remedies in the future, while 37% did not.[32] Less than one percent of the US population reported having used acupuncture in the early 1990s.[282] By the early 2010s, more than 14 million Americans reported having used acupuncture as part of their health care.[282]

In the US, acupuncture is increasingly (as of 2014) used at academic medical centers,[79] and is usually offered through CAM centers or anesthesia and pain management services.[283] Examples include those at Harvard University, Stanford University, Johns Hopkins University, and UCLA.[283][284] This usage has been criticized owing to there being little scientific evidence for explicit effects, or the mechanisms for its supposed effectiveness, for any condition that is discernible from placebo.[79] Acupuncture has been called 'theatrical placebo',[57] and David Gorski argues that when acupuncture proponents advocate 'harnessing of placebo effects' or work on developing 'meaningful placebos', they essentially concede it is little more than that.[79]

The use of acupuncture in Germany increased by 20% in 2007, after the German acupuncture trials supported its efficacy for certain uses.[285] In 2011, there were more than one million users,[285] and insurance companies have estimated that two-thirds of German users are women.[285] As a result of the trials, German public health insurers began to cover acupuncture for chronic low back pain and osteoarthritis of the knee, but not tension headache or migraine.[286] This decision was based in part on socio-political reasons.[286] Some insurers in Germany chose to stop reimbursement of acupuncture because of the trials.[287] For other conditions, insurers in Germany were not convinced that acupuncture had adequate benefits over usual care or sham treatments.[288] Highlighting the results of the placebo group, researchers refused to accept a placebo therapy as efficient.[289]

Regulation

There are various government and trade association regulatory bodies for acupuncture in the United Kingdom, the United States, Saudi Arabia, Australia, Japan, Canada, and in European countries and elsewhere. The World Health Organization recommends that before being licensed or certified, an acupuncturist receive 200 hours of specialized training if they are a physician and 2,500 hours for non-physicians; many governments have adopted similar standards.[290]
In China, the practice of acupuncture is regulated by the Chinese Medicine Council that was formed in 1999 by the Legislative Council. It includes a licensing exam and registration, as well as degree courses approved by the board.[291] Canada has acupuncture licensing programs in the provinces of British Columbia, Ontario, Alberta and Quebec; standards set by the Chinese Medicine and Acupuncture Association of Canada are used in provinces without government regulation.[278] Regulation in the US began in the 1970s[292] in California, which was eventually followed by every state but Wyoming and Idaho.[290][293] Licensing requirements vary greatly from state to state. The needles used in acupuncture are regulated in the US by the Food and Drug Administration.[293] In some states acupuncture is regulated by a board of medical examiners, while in others by the board of licensing, health or education.[290]

In Japan, acupuncturists are licensed by the Minister of Health, Labour and Welfare after passing an examination and graduating from a technical school or university.[294] Australia regulates Chinese medical traditions through the Chinese Medicine Board of Australia and the Public Health (Skin Penetration) Regulation of 2000. It restricts the use of words like "Acupuncture" and "Registered Acupuncturist".[citation needed] At least 28 countries in Europe have professional associations for acupuncturists.[294] In France, the Académie Nationale de Médecine (National Academy of Medicine) has regulated acupuncture since 1955.[295]

Prime number

From Wikipedia, the free encyclopedia https://en.wikipedia.org/wiki/Prime_number Composite numbers can...